(data stored in ACNUC7421 zone)

EMBL: CP000075.PE412

CP000075.PE412       Location/Qualifiers
FT   CDS_pept        446857..448275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0412"
FT                   /product="glutamate synthase (NADPH) small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35482"
FT                   /db_xref="GOA:Q4ZZE0"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35482.1"
FT                   /translation="MAERLSNDFQFIDVGRKDPKKKLLRQRKKEFVEIYEPFKPQQSAD
FT                   QAHRCLGCGNPYCEWKCPVHNFIPNWLKLVAEGNILAAAELSHQTNTLPEVCGRVCPQD
FT                   RLCEGACTLNDGFGAVTIGSVEKYITDTAFAMGWRPDMSKVVPTGKRVAIIGAGPAGLG
FT                   CADVLVRGGVTPVVFDKNPEIGGLLTFGIPEFKLEKSVLSHRREVFTGMGIEFRLNTEV
FT                   GKDVTIDQLLAEYDAVFMGMGTYTYMKGGFPGEDLPGVHDALDFLIANVNRNLGFEKAP
FT                   EDFVDMKGKRVVVLGGGDTAMDCNRTSIRQGAKSVTCAYRRDEENMPGSRKEVKNAKEE
FT                   GVKFLYNRQPIAIIGEGKVEGVKVVETRLGEPDARGRRSPEPIPGSEEIIPAEAVVIAF
FT                   GFRPSPAPWFEQFTISTDSQGRVVAPEQAQYKHQTSNPKIFAGGDMVRGSDLVVTAIFE
FT                   GRNAAEGILDYLGV"
     atggctgaac gtctcagtaa cgacttccag ttcatcgacg tcggacgtaa agacccgaag        60
     aagaaactgc tgcgtcaacg caagaaagag ttcgtggaaa tctacgagcc tttcaagccc       120
     cagcagtccg ccgatcaggc gcaccgctgc ctgggttgcg gcaacccgta ctgcgaatgg       180
     aagtgcccgg tgcacaactt cattcccaac tggctcaagc tggtcgccga gggcaatatc       240
     ctcgcggcag cggaattgtc gcaccagacc aacaccctgc cggaagtctg cggccgcgtg       300
     tgcccgcagg atcgcctgtg tgaaggtgcc tgcacactga acgacggttt cggtgcggtg       360
     accatcgggt cggtcgagaa gtacatcacc gataccgcct ttgccatggg ctggcgtccg       420
     gacatgtcca aggtcgtgcc gaccggcaag cgcgtcgcga tcatcggcgc agggcctgcg       480
     ggcctgggct gtgccgacgt gctggtgcgt ggcggcgtaa ccccggtggt gttcgacaag       540
     aatccggaaa tcggcggtct gctgaccttc ggcattccgg aattcaagct ggagaaatcc       600
     gtgctgagcc atcgccgtga agtgttcacc ggcatgggca tcgaattccg tctcaacacc       660
     gaagtcggca aggatgtcac catcgatcaa ctgctcgcag aatacgatgc ggtgttcatg       720
     ggcatgggca cctacaccta catgaaaggc ggcttccccg gtgaggatct gccaggcgtg       780
     cacgatgcgc tcgacttcct gatcgccaac gtcaaccgca acctgggctt tgaaaaggcc       840
     ccggaagact tcgtcgacat gaagggcaag cgggtcgtgg ttctgggcgg tggcgacacg       900
     gcgatggact gcaaccgcac ctctatccgc cagggcgcca agtcagtgac ctgcgcctac       960
     cgtcgcgacg aagaaaacat gcctggctcg cgcaaggaag tgaaaaacgc caaggaagaa      1020
     ggcgtgaagt tcctctacaa ccgtcagccg atcgccatca tcggcgaggg caaggttgaa      1080
     ggcgtgaaag tggtcgagac gcgcctgggc gaaccggatg cccgtggtcg tcgcagtccc      1140
     gagcctattc cgggctccga agagatcatc ccggcagaag ccgtggtcat cgccttcggc      1200
     ttccgcccaa gcccggcacc ctggttcgag cagttcacca tcagcaccga cagccagggc      1260
     cgtgtcgtgg ccccggaaca ggcgcagtac aagcaccaga ccagcaaccc gaagatcttc      1320
     gccggtggcg acatggtgcg cggctccgac ctggtggtga ccgctatctt cgaaggccgt      1380
     aatgcggctg aagggattct ggattacctg ggcgtctga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page