(data stored in ACNUC7421 zone)

EMBL: CP000075.PE413

CP000075.PE413       Location/Qualifiers
FT   CDS_pept        448609..451833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35483"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35483.1"
FT                   /translation="MLKAAPRGKLARSTEQQSLGPDRFTPSSIAVREHRNRERADRIID
FT                   QFVERFTEKDFFPDDGDDALFALLVQLPEWPADLSIRIHNESDEVLAVFLKGSDDSVVQ
FT                   SSILLTLNADAYIAPDDVPISDDEPLLHLIFSQLPVGSDLGTGGNFPGSNSVAGRIVTL
FT                   REQIAGLAKDQRPLLFDALVAANEDVSKSQLDTRTRNPLLPLWVRQQAFLTPALGVLCA
FT                   LCPEVPVARLEELLDQMPLTAQEETGFLERTLLPDAFGEALNISLDEWSSSLAIDGLAR
FT                   TRSFNTYTDELARRLASQLLTDTLGRALVIIEYGMSLYVTPGPDDTSIVLLHDDYGNYR
FT                   AQDTGNGEITSFKEGTDSFYLAISAQLKAEERALLGMQFEQDVKGFRELLTRLAIKENR
FT                   GWFDPGKPTEIESGFLPEWFAAAADVEKHRWKAAVQDYTQALLEAQAPDLLDPSGYGEP
FT                   EQLRNYAREKLRARILLDHGVAVDPDAVIVHTASIEIDPGIIIDTDYTYVGPSEIEPNV
FT                   ETQQRSLTELSLENIAVTDINFLLTGRAFDDHGQLISFLSAGYLFSLIRDLNVGENHVR
FT                   FLNTELLTSTAGQWHRERFASVMRAQMRLDALEAKMAGDFLGDGGLPPELANRGYKWLA
FT                   AVLDHPSEGGDRAAVEGHRIQVSQLSINGVTLNGILLVGAESLSSVASLVVFTPQVPDG
FT                   KCFREMSDAQALQQQVLLEPELLDYLVSRAPLASRGHVRHVLTSGRDTLFMALQPCTGS
FT                   FLDAVYESEVARVISAVDEQTNTTWETNWESAWEITKAVGDIVLTFAPFKVRLPMAALR
FT                   SFYAIWQGVATTADDKASAPLYFVQAALLLADGLALPKGRRVRTPAATSIGRSVLDPRT
FT                   AVARIPGGLKLRDDGFYKGVYEKSREDAPSRFYAVQHDKAYAVRYDADSAVWRVIDPRR
FT                   PDAYYQLPIQLDRQNVWVHASAGLRGGKKHSKPKSSSGSGSDSGSPDNGNRVRRYKVDL
FT                   EGFFESRNFKNAQKNIEDDLVVAVRKATERFELDGNGSLHKHGKTGFSLDLPGVGRSTG
FT                   RGAWRLILEPGEKGIIRAVDVKDPHK"
     gtgttgaaag cagcacccag gggcaagctt gcgcgctcca ctgaacagca atctctcggg        60
     ccggacaggt tcacgcccag tagcattgcc gttcgcgaac accggaaccg ggaacgggca       120
     gaccgcatca tcgaccagtt cgtcgagcgc ttcacagaaa aagatttttt tccggatgac       180
     ggcgatgacg ccttgtttgc cttgctggtt cagttgcctg aatggccagc agacctgtcg       240
     atcaggattc acaacgaaag cgacgaagtg ctcgcggttt tcctgaaggg cagcgatgac       300
     agcgtcgttc agagcagtat tctcctgacg ctaaacgctg acgcttatat tgcgccggat       360
     gatgttccga tctccgatga tgagccgctg ctgcacttga tcttcagcca gttgcctgtg       420
     ggttctgacc tcgggacggg aggtaacttt ccgggcagca acagtgtcgc cggacgaata       480
     gtaaccctgc gtgagcaaat cgccgggttg gcaaaagacc agaggccgct gttgttcgat       540
     gcccttgtgg cggcgaatga ggacgtttca aaaagccagc tggatacccg cacgcgtaac       600
     cctcttctgc ccctatgggt tcgtcagcag gcttttctga ctccggcgct gggcgtgctg       660
     tgtgccttat gcccagaggt tccggtcgca cgcctcgagg aattgctgga tcagatgccg       720
     ttgacggcgc aggaagaaac cggctttctg gagagaacac tattgccgga cgcttttggc       780
     gaagcgctga acatttctct ggatgagtgg agcagcagtc tggccattga tggtctggcg       840
     cgaacgcgca gcttcaatac ctatacggat gagctggccc gccgccttgc cagtcagctg       900
     ctgacggaca ccctggggcg agcactggtg atcatcgagt acggcatgag cctgtatgtc       960
     acgccaggcc ctgacgatac cagcatcgtt ttgctgcatg acgactacgg caattaccgt      1020
     gcacaggata ccggcaacgg tgaaatcact tcattcaagg agggcaccga cagcttttat      1080
     ctggcgatca gtgcgcaatt gaaggccgaa gaacgagcat tgctgggcat gcagttcgaa      1140
     caggacgtca aggggtttcg cgagctgctg actcgtcttg ccatcaagga aaatcgcggc      1200
     tggtttgacc ccggaaagcc gaccgaaatc gaaagcgggt ttctacccga gtggttcgcg      1260
     gccgcggccg atgtcgaaaa gcatcgctgg aaagcggcgg tgcaggatta cactcaggca      1320
     ttgctcgaag ctcaggcacc ggacctgctc gatccttccg gatacggaga gcccgagcag      1380
     ttgcgcaact acgcgcgtga gaaacttcgg gcgcgaatcc tgctcgacca cggggttgca      1440
     gtcgaccctg acgctgtcat tgtgcacacc gcgagcatcg agattgaccc aggcattatc      1500
     atcgatacgg attacaccta cgtcggtcct tcagagatcg agccgaatgt tgaaacgcag      1560
     cagcgcagcc tgacggagct gtctctggaa aacattgccg ttaccgatat caactttctg      1620
     ctcaccggtc gcgcgtttga cgatcatgga caactgatca gctttttgag cgccggttat      1680
     ctgttcagcc tgattcgtga tctgaacgtc ggcgaaaacc atgtccgatt cctcaacacc      1740
     gagttattga cctcgacagc cgggcaatgg caccgcgaac gtttcgcgag cgtcatgcgc      1800
     gcacagatgc gtctggacgc cctcgaagca aaaatggccg gagactttct tggcgatgga      1860
     gggctccctc ccgagttggc gaacagaggt tacaaatggc tcgccgccgt actggatcac      1920
     ccgtctgaag gtggcgatcg tgcggcggtg gaggggcacc gcattcaggt cagtcagttg      1980
     tcgatcaatg gtgtgacatt gaacggcata ctgctggtcg gcgcggagtc tctttccagc      2040
     gtggccagcc tggtggtgtt caccccgcag gtacccgacg gcaaatgctt ccgggaaatg      2100
     agcgatgcgc aggcacttca gcaacaagta ctgcttgagc ctgaattgct ggactatctg      2160
     gtgagcaggg ctcctctggc gtcccggggc catgtcaggc acgtcctgac ctctggccgt      2220
     gacacgctgt tcatggcgct gcagccctgc accggtagtt ttctcgatgc agtttacgag      2280
     tctgaagtcg cacgggtgat ttctgctgtc gacgaacaga ccaataccac gtgggaaacc      2340
     aattgggaga gcgcctggga aatcaccaag gctgttggcg atatcgtgct caccttcgca      2400
     cctttcaagg tgaggctgcc gatggccgcg ctgcgcagtt tttatgccat atggcagggc      2460
     gttgccacga cggctgatga caaggcaagc gccccgctgt atttcgttca ggccgcgctg      2520
     ctactggccg atggattggc gctgcccaag gggcgacggg tcaggacgcc cgcagcgacc      2580
     tccattggtc gttctgtcct cgatccgaga acagccgtgg caagaatccc cggcgggttg      2640
     aaattacgcg atgacggttt ttacaaaggc gtttacgaaa aaagccggga agacgcgccg      2700
     agccgctttt atgccgtgca acacgataag gcctatgccg tcaggtacga cgccgattcc      2760
     gcagtctggc gggtgatcga tccgcgccgg ccggatgcct attaccaatt gccgattcag      2820
     ctcgacaggc aaaatgtgtg ggtacacgcc tcggcaggtt tgcgcggtgg caagaagcat      2880
     tcaaaaccca agtcctccag tggctcgggc agtgatagcg gatcgccgga caacggtaac      2940
     cgcgtcagga ggtataaagt tgatctggag ggattttttg aaagtcgcaa cttcaagaac      3000
     gctcagaaaa acatcgaaga tgacctcgtc gttgcagtca ggaaggcaac agagcgattc      3060
     gaactggacg gtaacggcag tctgcataaa cacggcaaaa caggtttttc gctcgatctt      3120
     cccggtgttg gcaggagtac cggcagggga gcctggcgct tgatactcga acccggtgaa      3180
     aagggcatca tcagggctgt cgacgtcaag gatccgcaca aatag                      3225
//

If you have problems or comments...

PBIL Back to PBIL home page