(data stored in ACNUC7421 zone)

EMBL: CP000075.PE418

CP000075.PE418       Location/Qualifiers
FT   CDS_pept        complement(457049..457696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0418"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35488"
FT                   /db_xref="GOA:Q4ZZD4"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR013467"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35488.1"
FT                   /translation="MRRIIKGTEPASFTEWKASANEDWTPTYPTLQNPQKRDLHDRLLQ
FT                   EQNFSCCYCGREIELDSSHIEHFRPQDHYLPLALEFSNLHASCLRETTPGSPLHCGHYK
FT                   GNWFDEDLHISPTEDDCEQRFRYLLTGKIQSTSHTDLPATTMIEKLALDIAYLTKRRQE
FT                   AITGVFDEQFISSASDAELANLVDSLRSGTANTSIAFGHVVARYAEQLLTQR"
     atgagacgca tcatcaaagg aactgagcct gcgtcattca ccgaatggaa agccagtgca        60
     aacgaagact ggacgcccac ttatccaacc ttgcagaacc cgcaaaaacg cgacctgcat       120
     gatcgcctgc tgcaagagca gaacttctca tgctgctatt gcggcaggga aatagaactt       180
     gatagcagtc acatcgaaca tttcagaccg caggatcatt atctgccatt ggcactggag       240
     ttcagcaatc ttcatgcgtc ctgcctgcgc gagaccacac caggaagccc gttgcactgc       300
     ggccactaca agggcaactg gttcgatgaa gacctgcaca tctctccgac agaggacgat       360
     tgcgaacagc gcttccgtta cttgctgaca gggaaaatcc agagcacatc ccacaccgac       420
     cttcccgcca cgacgatgat cgaaaagctc gcactcgata tcgcgtatct gaccaaaaga       480
     cgtcaggagg ccatcacggg tgtgttcgat gaacagttca tatccagcgc cagcgatgcg       540
     gaactcgcta accttgtaga cagcctgcgc tcgggcaccg ctaatacctc tattgctttc       600
     ggccatgtcg ttgcgcgcta tgcggagcaa ttgctgacgc agcggtag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page