(data stored in ACNUC7421 zone)

EMBL: CP000075.PE420

CP000075.PE420       Location/Qualifiers
FT   CDS_pept        complement(459036..460304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0420"
FT                   /product="General substrate transporter:Major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35490"
FT                   /db_xref="GOA:Q4ZZD2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35490.1"
FT                   /translation="MNPAVAPPTPDLNTSSVQSSTLPGDTYIEKNTPLFKRTALALFAG
FT                   GFSTFTLLYCVQPMMPTLSSEFSLTAAQSSLILSVATAMLAIGLLITGPISDRLGRKPV
FT                   MVMALFCASLFTIASALMPSWEGVLITRALVGLSLSGLAAVAMTYLSEEIHPTHLGLAM
FT                   GLYIGGSAVGGMSGRLIVGVMIDYVSWHAAMLVVGGLALIAAAVFWKILPASRNFRPRS
FT                   LHPRSLLDGFVVQFRDAGLPLLFLTGFLLMGAFVTLFNYIAYRFLSAPYNLSQAVVGVF
FT                   SVVYLSGIYSSAKIGSLADRLGRRQVLWAVIVMMLAGLLLTLFTPLPLVIVGVLIFTFG
FT                   FFGAHSVASSWVGRRATTARGQAASLYLFCYYAGSSVAGTGGGVFWHYAGWNGIGVFIG
FT                   VLLLIALGVALRLARLQPLGSQV"
     gtgaaccctg ccgttgcccc gcccaccccc gacttgaaca cctcgtccgt acagtcgtcg        60
     acactgccgg gcgataccta catcgagaag aacacgccac tgttcaaacg cactgcactg       120
     gcgctgttcg ctggcgggtt ttcgactttt accctgctgt actgcgttca gccgatgatg       180
     cccacgctgt ccagcgagtt ctccctgact gcggcacaaa gcagcctgat cctgtccgtc       240
     gccacagcaa tgctcgccat cggcctgctg atcaccgggc cgatatccga tcggctgggg       300
     cgcaagccgg tgatggtcat ggcgctgttc tgtgcctcgc tgttcaccat cgccagcgcc       360
     ttgatgccca gctgggaggg cgtgctgatt acccgagctc ttgtaggtct ttcgttgagc       420
     ggcctggcgg cagtggcgat gacctacctg agcgaggaga tccaccccac ccatctgggc       480
     ctggcgatgg ggctgtatat cggcggcagc gccgtcggtg gcatgagcgg aaggctgatc       540
     gtcggggtga tgatcgatta tgtcagctgg cacgcggcga tgctggtggt cggcgggctg       600
     gcgctgatcg ccgcagcggt gttctggaag atcctgccgg cgtcacgcaa cttccgcccg       660
     cgctcgctgc accctcgcag tctgctcgac ggctttgtcg tgcagtttcg cgatgcaggc       720
     ctgccgctgc tgtttctgac cggttttctg ctgatgggcg cattcgttac gctgttcaac       780
     tacatcgcct accgctttct gagcgccccc tacaacctga gccaggccgt ggtcggtgtg       840
     ttttccgtgg tgtacctgtc gggcatctac agttcagcaa agatcggctc gctggctgac       900
     cgcctaggcc gccgacaggt gctctgggcc gtgatcgtga tgatgctggc cggcctgctg       960
     ctgaccctgt tcaccccact gccactggtg atcgtcggtg tgctgatctt caccttcggc      1020
     ttcttcggcg cacattcagt ggccagcagt tgggtcggac gcagggccac caccgccaga      1080
     ggccaggccg cgtccctgta cctgttctgt tactacgcag gttcgagcgt ggccggcacc      1140
     ggcggcggcg tgttctggca ctacgcaggc tggaacggta tcggggtgtt tataggcgtg      1200
     ttgctgctga tcgcccttgg tgtggcgttg aggttggcaa ggttgcagcc gctggggtcg      1260
     caggtttag                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page