(data stored in ACNUC7421 zone)

EMBL: CP000075.PE423

CP000075.PE423       Location/Qualifiers
FT   CDS_pept        complement(462773..463501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0423"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35493"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35493.1"
FT                   /translation="MTESILVTGSSRGIGRAIALRLAQAGYDLILHCRTGRSEAEAVQA
FT                   EVVALGRQARVLQFDVSDRAACKAVLEQDVETHGAYYGVVLNAGLTRDGAFPALSDDDW
FT                   DQVLRTNLDGFYNVLHPLTMPMIRRRTAGRIVCITSVSGLIGNRGQVNYSASKAGLIGA
FT                   AKALAIELGKRKITVNCVAPGLIDTAMLDENVPVDELLKMIPAQRMGTPEEVAGAVNFL
FT                   MSTEASYITRQVLAVNGGLC"
     atgactgaat cgatactggt caccggctcc agccgtggca ttggccgcgc catcgccctg        60
     cgtctggcgc aggccggata cgacctgatc ctgcattgcc gcaccggccg cagcgaagcc       120
     gaagcggtgc aggccgaagt cgttgcgctg ggccgtcagg cacgcgtgct gcaattcgat       180
     gtctcggacc gggccgcctg caaggccgtt ctggaacagg acgtggagac gcacggcgcc       240
     tattacggcg tggtgctcaa cgccgggctg acccgcgacg gcgcgtttcc ggcgctcagc       300
     gacgatgact gggatcaggt gctgcgcacc aacctggacg gcttctataa cgtcctgcac       360
     ccgttgacga tgccgatgat tcgccgtcgt acagcagggc gcatcgtctg catcacttcg       420
     gtttccgggc tgatcggcaa ccgcggccag gtcaattaca gcgcttccaa ggcagggctt       480
     atcggtgctg ccaaggccct ggctatcgag ctgggcaagc gcaagatcac cgtcaactgc       540
     gtcgcgccgg ggctgatcga taccgccatg ctcgacgaga acgtgccggt ggacgaactg       600
     ctgaaaatga ttccggcaca acgcatgggc acgcccgagg aagtggcggg tgcggtgaat       660
     tttctgatgt cgaccgaagc gagctacatc actcgtcagg ttctggccgt caacggggga       720
     ctgtgctga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page