(data stored in ACNUC7421 zone)

EMBL: CP000075.PE424

CP000075.PE424       Location/Qualifiers
FT   CDS_pept        complement(463498..463953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35494"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35494.1"
FT                   /translation="MTEWPLAELIPHAGDMILIDQVLSFDEEQIRTRLTVRADGLFNQA
FT                   DGSLPAWLGIELMAQSVAAYAGCKARNKGEAVKLGFLLGSRKFDCNVTRFPLGSELHIH
FT                   AVRSLQDDNGMGMFECTLTGPGIEAFARLNVYCPPNTADYLAEGAPA"
     atgaccgagt ggccgctcgc cgaactcatc ccccatgccg gcgacatgat tctcatcgat        60
     caggtgctga gctttgacga agagcagatt cgaacccgcc tgaccgtgcg cgccgacggc       120
     ctgttcaatc aagccgacgg cagtctgccg gcatggctgg gcatcgagct gatggcgcag       180
     agcgtcgcgg cctatgccgg ttgcaaggcg cgcaacaagg gcgaagcggt caagctgggg       240
     tttctgcttg gcagccgcaa gttcgactgc aacgtgacgc gcttcccgct gggcagcgaa       300
     ctgcacatcc acgccgtgcg ttccctgcag gacgacaacg gcatgggcat gttcgaatgc       360
     accctcaccg gtccgggtat cgaggctttt gcccgactca atgtatattg cccgcccaat       420
     actgctgact acctggctga aggagccccg gcatga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page