(data stored in ACNUC7421 zone)

EMBL: CP000075.PE427

CP000075.PE427       Location/Qualifiers
FT   CDS_pept        complement(465622..466356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35497"
FT                   /db_xref="GOA:Q4ZZC5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35497.1"
FT                   /translation="MNRPFLSDSYVEETRFGLWFLRSNIWQYRVLRVAIDDLRSLFASA
FT                   PPVAPVLLDAGCGQGRSFQHLNKVFQPSRLIGVDADPHSLDMSREEARARGVEVELIGS
FT                   DCAALPVPDASVDLLFCHQTFHHLVDQERALAEFYRVLKPGGYLLFAESTEAYIDTWVI
FT                   RWLFRHPMHVQKSAAQYLQMIRDQGFEFDAQNVSYPYLWWSRARDFGLLEVLKLQKPRP
FT                   FGQREETLVNVVARKPLEVGAS"
     atgaatcgac cgttcctgag tgacagttat gtcgaggaaa cccgcttcgg cctgtggttt        60
     ctgcgcagta acatctggca gtaccgcgtg ctgcgcgtgg cgatagacga cttgcgcagc       120
     ctgttcgcca gcgcgccgcc ggttgcgccg gtgttgctcg acgccgggtg cgggcaaggc       180
     cgctcgttcc agcacctgaa caaggttttt cagccctcca ggctcatcgg tgtcgacgcc       240
     gacccgcaca gcctcgacat gagtcgtgaa gaggcgcggg ccagaggcgt agaggtcgaa       300
     ctgatcggca gcgactgcgc agccctgcca gtacccgacg ccagcgtcga tctgctgttc       360
     tgccaccaga ctttccatca tctggtcgat caggaacggg cgctggccga gttttatcgc       420
     gtgctcaagc cgggcggcta tctgctgttc gccgagtcga ccgaggcgta catcgacacc       480
     tgggtgattc gctggctgtt ccgccacccg atgcacgttc agaaaagcgc ggcgcagtat       540
     ctgcagatga tccgcgacca gggtttcgag ttcgatgcac agaatgtttc gtacccttac       600
     ctgtggtgga gccgcgccag ggacttcggc ctgctcgaag tcttgaaact gcaaaagccc       660
     aggccattcg ggcaacgtga ggaaacgctg gtcaatgtcg tggcccgcaa acccctggaa       720
     gttggagcat catga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page