(data stored in ACNUC7421 zone)

EMBL: CP000075.PE435

CP000075.PE435       Location/Qualifiers
FT   CDS_pept        complement(474481..475026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0435"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35505"
FT                   /db_xref="GOA:Q4ZZB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35505.1"
FT                   /translation="MKRLIGLILVLAGVLYPFAVYWGTEHFAPWQFALLLGSLWLARAL
FT                   TGERRQGSLAMAIVALIFCVVLGALDSHMMLRWYPVLVSTFMLGLFGSSLVYGPPIVEK
FT                   MARLNRPDLPEAGIRYTRKVTQIWCLFFLVNGLTSAILTLWAPLSWWTLYTGLISYGLM
FT                   GVLFAVEWIVRPPSAGGK"
     atgaagcggc tgattggcct gattctggtg ctggccggcg tgctgtatcc attcgccgtc        60
     tattggggga ccgagcattt cgccccctgg cagttcgcgc tgctgctcgg cagcctgtgg       120
     ctggcgcgcg ccctgaccgg agagcgcagg caaggcagcc tggcgatggc gattgtcgcg       180
     ctgatctttt gcgtggtgct cggcgccctc gacagtcaca tgatgctgcg ctggtatccg       240
     gtactggtca gcaccttcat gctcggtctg ttcggttcaa gccttgtcta cggcccgccg       300
     atcgtggaaa agatggcgcg cctgaaccgc cccgatctgc ctgaggccgg tattcgctac       360
     acccgtaaag tcacgcagat ttggtgcctg ttctttctcg tcaacggcct cacgtcagcc       420
     atcctgacgc tgtgggcacc gttgtcatgg tggacgctgt acaccggcct gatttcctac       480
     ggcctgatgg gcgtgttgtt cgctgtcgaa tggatcgtcc gcccaccctc tgcgggcggc       540
     aaatga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page