(data stored in ACNUC7421 zone)

EMBL: CP000075.PE436

CP000075.PE436       Location/Qualifiers
FT   CDS_pept        complement(475023..475277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0436"
FT                   /product="Phosphopantetheine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35506"
FT                   /db_xref="GOA:Q4ZZB6"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35506.1"
FT                   /translation="MQTREDIFEILRAAMVELFELEPERVTLEANLYQDLEIDSIDAVD
FT                   LIDHIKRKTGKKIAAEEFKSVRTVKDVVEAVYKLVNTAE"
     atgcaaaccc gtgaagacat cttcgaaatc ctgcgcgccg caatggtgga actgttcgaa        60
     ctggagcctg agagagtcac gcttgaagcc aacctgtatc aggacctgga gatcgacagt       120
     atcgatgccg tggacctgat cgatcacatc aaacgcaaga ccggcaagaa gattgcggct       180
     gaagagttca agtcggtgag aaccgtgaag gacgtggtag aagccgtgta caaactggtc       240
     aataccgccg aatga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page