(data stored in ACNUC7421 zone)

EMBL: CP000075.PE437

CP000075.PE437       Location/Qualifiers
FT   CDS_pept        complement(475287..475547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0437"
FT                   /product="acyl carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35507"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35507.1"
FT                   /translation="MSDLHQDIKLLIIDALGLEDITPEDIGNDMTLFGEGLGLDSVDAL
FT                   ELGLAIQKRYGIRIDADAKDTRNHFASVDSLAAFVSARQPA"
     atgagcgatc tgcaccagga cattaaattg ttgatcatcg atgccctggg cctcgaagac        60
     atcaccccgg aagatatcgg caacgatatg acgctgtttg gcgaaggact gggactggac       120
     tcggtggatg cactcgaatt gggcctggcc atccagaagc gttatggcat caggatcgat       180
     gccgatgcaa aggacacccg taaccatttc gccagcgtcg acagccttgc ggccttcgtc       240
     agcgccagac aaccggcctg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page