(data stored in ACNUC7421 zone)

EMBL: CP000075.PE439

CP000075.PE439       Location/Qualifiers
FT   CDS_pept        complement(476310..477029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35509"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35509.1"
FT                   /translation="MITFNIARWQAWAPGLASAEDWQRWSLDPTLLETSDAAPDVSFLP
FT                   AMQRRRLGRMARMAFAVGWPLTEGLGRVPLVFVSRHGETPRTFEILRDLAANEPLSPTQ
FT                   FSLSVHNAVIGLWSIMRGETSEMTALAATGDGLEYGAFEAAALLAEGAEAVLLVVTEEQ
FT                   PPQAYAQWIDDVPFPYAVGLLLTPGNEWQLSLNTDTQGTTRTQWPHALNLLRALHTDQS
FT                   VCLHPWNNRLWNWQRSH"
     ttgatcacct tcaacattgc acgatggcaa gcctgggcgc cgggcctggc gagcgcggaa        60
     gactggcaga ggtggagcct cgatccgacg ttgctggaaa ccagtgacgc agcgccagac       120
     gtgtcttttc ttcctgcgat gcaacgccgc cgcctgggcc gtatggcaag aatggcgttt       180
     gctgtcggct ggccgttgac tgaagggctg gggcgcgtcc cgctggtgtt tgtctcgcgc       240
     cacggagaaa ccccgaggac ctttgaaatc ctgcgtgatc tggccgccaa cgagccgctt       300
     tcaccgaccc agttcagcct ttcagtgcat aacgccgtaa ttggtctgtg gtcgatcatg       360
     cgcggtgaaa caagtgagat gacagccctg gccgccacag gcgacgggct ggagtatgga       420
     gcattcgagg ccgcagcgtt gctggccgag ggagcagaag cagtattgct tgtggtgact       480
     gaagaacagc caccgcaagc ctatgcccaa tggattgatg acgtgccctt tccctacgcg       540
     gtcggcttgc tgctgacgcc ggggaatgag tggcagctgt ctctgaacac cgatacgcaa       600
     ggcacaacgc gcactcagtg gcctcacgcc ctgaacctgc tgcgggcctt gcacactgat       660
     caatccgtct gcctgcaccc ttggaataac cggttatgga actggcaacg cagtcactga       720
//

If you have problems or comments...

PBIL Back to PBIL home page