(data stored in ACNUC7421 zone)

EMBL: CP000075.PE44

CP000075.PE44        Location/Qualifiers
FT   CDS_pept        complement(45231..45776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0044"
FT                   /product="transferase hexapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35118"
FT                   /db_xref="GOA:Q500Q4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35118.1"
FT                   /translation="MAIRKFQEHTPALGERAFVDHSAVVIGDVEIGADSSVWPLTVVRG
FT                   DMHRIRIGARTSVQDGSVLHITHAGPFNPDGFPLLIGDEVTIGHKAMLHGCTIGNRILV
FT                   GMGTTIMDGAVVEDEVIIGAGSLVPPGKVLESGFLYVGRPVKQVRALTEKEIAFFPYSA
FT                   TNYVKLKDQHLAEGFDKG"
     gtggccattc gcaagtttca ggagcacacc ccagccctcg gcgaacgggc ctttgtcgat        60
     cattcagcgg tggtaatcgg tgacgtcgaa atcggcgccg acagctccgt ctggccgctg       120
     accgtggtgc gcggcgacat gcaccggatc cgcatcggcg cccgcaccag cgtgcaggac       180
     ggcagcgtgc tgcacatcac ccacgccggc cccttcaacc cggacggttt tccgctgctg       240
     atcggcgatg aagtgaccat cggccacaag gccatgctgc acggctgcac aatcggcaat       300
     cgcatcctgg tcggcatggg caccaccatc atggacggcg cggtcgttga agacgaagtg       360
     atcatcggcg ccggcagcct ggtaccgccg ggcaaagtgc tggaaagcgg ctttttgtac       420
     gtcggtcgcc cggtcaaaca ggtgcgcgcc ctgaccgaaa aggaaatcgc cttcttcccg       480
     tacagcgcga ctaattacgt gaagctcaag gatcagcatc tggcggaagg gtttgataag       540
     ggttga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page