(data stored in ACNUC7421 zone)

EMBL: CP000075.PE442

CP000075.PE442       Location/Qualifiers
FT   CDS_pept        479613..481289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0442"
FT                   /product="Malonate decarboxylase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35512"
FT                   /db_xref="GOA:Q4ZZB0"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35512.1"
FT                   /translation="MTTTTSPDARWTRRRSEKQRRLQQVRALADGVVLPTDNIVAALEA
FT                   LLVSGDRVVLEGNNQKQADFLSRALAKVDPGKVHDLHMIMPSVGRAEHLDLFEQGIARK
FT                   LDFSFAGTQSLRISQLLEDGLLEIGAIHTYIELYSRLVVDLIPNVVLAAGFMADRAGNI
FT                   YTGPSTEDTPALIEPAAFSDGIVIVQVNQLVDDVSELPRVDIPASWVDFVVVADKPFYI
FT                   EPLFTRDPRHIKPVHVLMAMMAIRGIYEKHNVQSLNHGIGFNTAAIELILPTYGESLGL
FT                   KGKICRNWTLNPHPTLIPAIESGWVESVHCFGTELGMENYIAARPDVFFTGRDGSLRSN
FT                   RQLCQLAGQYAVDLFIGATLQVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGRRHATPAW
FT                   LDMRQQHDDGPAAYLERGKKLVVQMVETFQEGGKPTFVETLDAVEVAKKSGMPLAPIMI
FT                   YGDDVTHLLTEEGIAYLYKARSLEERQAMIAAVAGVTVIGLRHNPKDTARMRREGLIAL
FT                   PEDLGIRRTDASRELLAAKSIADLVQWSGGLYNPPAKFRSW"
     atgacaacaa caacttcccc cgacgcacgc tggacacgtc gtcgcagcga gaagcagcgg        60
     cgtctgcagc aagtacgggc gttggccgac ggtgtggtgt tgccgaccga caacatcgtt       120
     gcggcgctgg aggccctgct ggtttccggc gaccgcgtgg tgcttgaagg caacaaccag       180
     aagcaggcgg acttcctctc ccgcgcgctg gccaaagtcg atccgggcaa ggtgcatgac       240
     ctgcacatga tcatgccgag cgtcggccgc gccgagcacc tggacctgtt cgagcagggc       300
     attgcgcgca agctggactt ctcgttcgcc ggtacgcaaa gcttgcgcat cagtcagttg       360
     ctggaagacg gcctgctgga aatcggtgcg atccacacct acatcgaact ctattcacgg       420
     ctggtagtgg acctgatccc caacgtggtg ctggcggcag gcttcatggc cgaccgcgcc       480
     ggcaacatct acaccggacc cagcaccgaa gacacccccg cactcatcga accggcggca       540
     ttcagcgacg gcatcgtcat tgtccaggtc aatcaactgg tcgatgacgt cagcgagctg       600
     ccacgcgtgg acatcccggc ctcgtgggtc gactttgtgg tggtcgccga caagccgttc       660
     tatatcgaac cgctgttcac ccgcgacccg cgccacatca agccggtgca tgtgttgatg       720
     gcgatgatgg cgattcgcgg catctacgag aaacacaacg tccagtcgtt gaaccacggc       780
     atcggtttca ataccgccgc cattgagctg attttgccga cctacggcga gtcgctgggc       840
     ctgaagggca agatctgccg caactggaca ctcaatccgc acccgacgct gatcccggcc       900
     atcgaaagcg gctgggtcga gagcgtgcat tgtttcggca ccgagctggg catggaaaat       960
     tacatcgccg cccgcccgga cgtgttcttc accggacgcg acggctcgct gcgttccaac      1020
     cgccagctct gccaactggc cgggcagtac gcggtggacc tgttcatcgg tgcaaccttg      1080
     caggtcgatg gcgacggaca ttcctcgacg gtaacccgtg gtcgtctggc cggctttggt      1140
     ggcgcgccga acatgggcca cgacccacgc ggccggcgtc atgccacgcc cgcctggctc      1200
     gacatgcgtc agcagcacga tgacggcccg gctgcctacc tggagcgcgg caagaaactg      1260
     gtggtgcaga tggtcgagac gttccaggag ggtggcaaac cgaccttcgt cgaaaccctg      1320
     gacgccgtcg aggtggcgaa gaaaagcggc atgccgctgg cgccgatcat gatctacggc      1380
     gacgacgtga cccacctgct gaccgaagaa ggcatcgcct acctctacaa ggcacgcagc      1440
     cttgaggaac gccaggcgat gatcgcggcg gtggcgggcg tgaccgtgat cggtttgcgc      1500
     cacaacccca aggacaccgc gcgcatgcgc cgtgaagggc tgatcgcgtt gcccgaagac      1560
     ctcgggatcc gccgcaccga tgccagccgt gaactgctgg ccgccaagag cattgccgac      1620
     ctggttcagt ggtccggtgg cctctacaac ccgcctgcca aattcaggag ctggtaa         1677
//

If you have problems or comments...

PBIL Back to PBIL home page