(data stored in SCRATCH zone)

EMBL: CP000075.PE444

CP000075.PE444       Location/Qualifiers
FT   CDS_pept        482166..482465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0444"
FT                   /product="Malonate decarboxylase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35514"
FT                   /db_xref="GOA:Q4ZZA8"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35514.1"
FT                   /translation="METLSFEFPAGQPPKGRALVGVVGSGDLEVLLEPGKPGTLSIQVV
FT                   TSVNGAALRWQHLFERMFDGQTPPALSIDIHDFGATPGVVRMRLEQGFEEIGHD"
     atggaaaccc tgtcttttga atttcctgcc ggacagccgc ccaagggccg tgcgctggtg        60
     ggtgtggtgg gctccggtga tctggaagtg ctgctggagc ccggtaagcc gggcaccttg       120
     tcgattcagg tagtgacgtc ggtcaacggt gccgcgctgc gctggcagca tctgttcgaa       180
     cgcatgttcg acggccagac cccgcctgcg ctgagcatcg atattcatga cttcggcgcg       240
     acgcccggcg ttgtgcgtat gcgcctggag caaggcttcg aggagatcgg tcatgactga       300
//

If you have problems or comments...

PBIL Back to PBIL home page