(data stored in ACNUC7421 zone)

EMBL: CP000075.PE445

CP000075.PE445       Location/Qualifiers
FT   CDS_pept        482458..483309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0445"
FT                   /product="malonate decarboxylase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35515"
FT                   /db_xref="GOA:Q4ZZA7"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35515.1"
FT                   /translation="MTDNARLLNQHSFIELGARQRARALLDAGSFRELLGPFDRVMSPW
FT                   LAMQGVVPQADDGVVVGKGTVDGRPVVIAAIEGSFQGGSMGEVGGAKMAGALELAAEDN
FT                   RNGIPTAAIVLLETGGVRLQEANLGLAAIAEIHAAIVDLRQYQPVIGVVAGSVGCFGGM
FT                   SIAAGLCSYLLVTQEARLGLNGPQVIEQEAGIEEYDSRDRPFIWSLTGGEQRFASALVD
FT                   GFAADDVADVRQQVSGWLKQGVPDTHRSSQYPLFLQRLASLDTEPQIDPQSVRTLYQGA
FT                   RS"
     atgactgata acgcacggtt gctgaatcag cacagtttca tcgaactggg tgcccgacag        60
     cgcgcccgtg ccttgctgga tgccggcagt ttccgcgaac tgctcggtcc gttcgatcgg       120
     gtcatgtcgc cgtggctggc catgcagggc gtggtgcctc aggcggatga tggcgtggtg       180
     gtcggcaaag gcactgtcga tggtcggcca gtggtcatcg ccgccatcga aggttctttt       240
     cagggcggca gcatgggcga agtcggcggt gcgaagatgg ccggtgcgct ggaactggcc       300
     gccgaagaca accgcaacgg cattcctacc gccgcgatcg tgctgctgga aaccggtggc       360
     gtgcgtttgc aggaagccaa tctgggcctg gccgcgattg ccgagattca tgccgcgata       420
     gtcgacctgc gtcagtacca gccggtgatc ggtgtggtgg ccggcagcgt cggctgcttt       480
     ggcgggatgt ccatcgccgc agggctgtgc agttacctgc tggtgactca ggaagcacgt       540
     ctgggcctga acggtccgca ggtgatcgag caggaagccg gcatcgaaga atacgactcc       600
     cgcgaccgtc cgttcatctg gagcctgacc ggtggcgagc aacgctttgc cagcgcgctg       660
     gtggatggtt ttgctgccga tgatgtcgcc gatgtgcgcc agcaggtcag cggctggctc       720
     aagcagggcg tgcccgacac gcatcgcagc agtcagtacc cactgttcct gcaacgtctg       780
     gccagcctcg acactgaacc gcaaatcgat ccgcaaagcg tgcgcaccct ctatcaagga       840
     gcccggtcat ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page