(data stored in ACNUC7421 zone)

EMBL: CP000075.PE446

CP000075.PE446       Location/Qualifiers
FT   CDS_pept        483306..484106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0446"
FT                   /product="Malonate decarboxylase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35516"
FT                   /db_xref="GOA:Q4ZZA6"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35516.1"
FT                   /translation="MSHSQRGLNWFNALSAGAREVTGLPASLKVADGVLGEQPVRFLAV
FT                   IADTDNCFPRARQGEVGLLEGWGLAKAVDEAIEQDRDRAEKRALIAIVDVPSQAYGRRE
FT                   EALGIHQALAGAVDSYARARLAGHPVIGLLVGKAMSGAFLAHGYQANRLIALRDPGVMV
FT                   HAMGKASAARVTLRSVEDLEKLAASIPPMAYDIDSYASLGLLWETLTVKQIEQPAADDL
FT                   VQVRNVLSSAIKDVQARGVDLSSRLGASNRAASVNVRQLLRAQW"
     atgagtcatt cacaacgggg tttgaactgg ttcaacgcct tgagcgcagg tgcccgtgaa        60
     gtcactggcc tgcctgcctc actcaaggtg gcggatggcg tgctgggcga gcagccggtg       120
     cgttttctgg ccgtgattgc cgataccgac aactgctttc cccgggcacg tcagggcgaa       180
     gtcggcctgc tggaaggctg gggcctggcc aaagcggtgg acgaggctat cgagcaggat       240
     cgcgaccgcg ccgaaaagcg cgcactgatt gccatcgtcg acgtcccgag ccaggcctac       300
     gggcgtcgcg aggaagcgct cggtatccat caggcactgg ccggggctgt ggacagttat       360
     gcgcgagcac gtctggccgg gcatccggtg atcggcctgt tggtcggcaa agcgatgtcc       420
     ggcgcatttc tggcccacgg ctatcaggcc aatcgattga tcgcgctgcg tgatcccggc       480
     gtgatggtgc atgcgatggg caaggcttcg gcagcccgcg taaccctgcg cagcgtcgag       540
     gatctggaaa agctcgccgc cagcattccg ccgatggctt acgacattga cagctacgcc       600
     agcctcggtc tgttgtggga aaccctgacg gtcaagcaga tcgaacagcc cgctgcggat       660
     gacctggttc aggtgcgcaa cgtgctgagc agtgcgatca aggacgtaca ggcccgcggc       720
     gtcgatctga gcagccgcct gggcgcgagc aaccgtgcgg cgtcggtcaa tgtgcgccag       780
     ttgctgcggg cgcaatggtg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page