(data stored in ACNUC7421 zone)

EMBL: CP000075.PE447

CP000075.PE447       Location/Qualifiers
FT   CDS_pept        484100..484741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0447"
FT                   /product="malonate decarboxylase subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35517"
FT                   /db_xref="GOA:Q4ZZA5"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35517.1"
FT                   /translation="MVISNTGAVLPHDLLWGMPLTALPDDAPKWAVEAVLAGQPVVVRR
FT                   QAMPAGQQVAVGLRGRGREQRYAASMPLAEVCRRVMPEQLIDAPTEIHQQWPALQALRQ
FT                   IRPVMEALELDWGVGGSAGFELASGIAALHQDSDLDLILRTPGRLNRRCAAELVEALET
FT                   SVCRVDVQLQLESGAVALREWARPTGRVLLKTATGARLVADPWHLGQVCA"
     atggtgatca gcaacacggg tgcagtgctg ccccatgatt tgttgtgggg catgccgctg        60
     actgcgttgc cggacgatgc gcccaaatgg gcggtcgagg ccgtgctggc cgggcaaccg       120
     gtggtggtgc ggcgtcaggc aatgcccgcc gggcagcagg tggcggtggg cttgcgcggt       180
     cgcggtcggg agcagcgcta tgccgcgagt atgccgctgg ctgaggtctg ccgaagggtc       240
     atgcccgagc agttgatcga cgccccgacc gagattcatc agcaatggcc ggcgttgcag       300
     gcgttgcgcc agatccgtcc ggtcatggag gcgctggagc tggactgggg cgtcggcggc       360
     agtgccggat tcgagctggc cagcggtatt gcggcgttgc atcaggacag cgatctggat       420
     ctgattctgc gcacccccgg acgcttgaat cgccgctgtg ccgccgagct ggtcgaagcg       480
     ctggaaacct cggtctgtcg ggtcgacgtc cagctgcaac ttgagtctgg tgccgtggcg       540
     ctgcgtgagt gggcgcggcc aacggggcgg gtgctgctca agaccgccac cggcgcgcgg       600
     ctggttgcag acccgtggca cctgggtcag gtgtgcgcat ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page