(data stored in ACNUC7421 zone)

EMBL: CP000075.PE449

CP000075.PE449       Location/Qualifiers
FT   CDS_pept        485743..486159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0449"
FT                   /product="Malonate transporter MadL subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35519"
FT                   /db_xref="GOA:Q4ZZA3"
FT                   /db_xref="InterPro:IPR004690"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35519.1"
FT                   /translation="MIIYGVALLAICTLAGVILGDMLGVLLGVKSNVGGVGIAMILLIC
FT                   ARLWMEKHGGMSKDCEMGVGFWGALYIPVVVAMAAQQNVVTALKGGPVAVLAAVGSVVL
FT                   CACTIALISRTNRGEPLPKEEPLLTPEIAPAGGR"
     atgattatct acggtgttgc actactggcc atctgcacgc ttgcgggcgt gattctcggc        60
     gacatgctcg gcgttctgct gggcgtgaaa tccaatgtgg gcggggtcgg gatcgccatg       120
     atcctgttga tctgcgcgcg cctgtggatg gaaaaacacg gcggcatgag caaggactgc       180
     gaaatgggcg tgggtttctg gggcgcgctg tacatcccgg tggtggtggc gatggctgcg       240
     caacagaatg tcgtcaccgc gctcaaaggc gggcctgttg ccgttctggc cgccgtcggt       300
     tcggtggtgt tgtgtgcctg caccattgct ttgatcagcc gtaccaaccg gggcgagcca       360
     ttgcccaagg aagagccgct gctgacgcct gaaatcgccc cggccggagg tcgctga          417
//

If you have problems or comments...

PBIL Back to PBIL home page