(data stored in ACNUC7421 zone)

EMBL: CP000075.PE451

CP000075.PE451       Location/Qualifiers
FT   CDS_pept        complement(486927..487853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0451"
FT                   /product="regulatory protein, LysR:LysR, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35521"
FT                   /db_xref="GOA:Q4ZZA1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037400"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35521.1"
FT                   /translation="MQIDDELTLKKLEIFLAFMRTGNLARAAEELQTSNVSVHRAIHSL
FT                   ESALRCPLFKHEGRNLTPLESAYVLEERAQKLVQDVLATVELTRQAAGFSAARFRLGAL
FT                   YSLTVKTVPQLIMGLKIRRSELNIDLILGSNMDLLYKLKNMEVDAMLVSLDESTHDPDC
FT                   EHLALFSDDIFLAVPTDSPFAEHPEVDLSDLREATFITLTQGFATHRDGIRVFQQAGFE
FT                   PKVAMQVNDIFTLLSMVSSGVGYALLPGRIAAVYENRVRLIPLQSRYRMQQHIGIVFLK
FT                   SKQRDPNLLALLAECRMYTNRLLEQTT"
     atgcagatcg atgacgaact gacgctcaag aaactggaaa tattcctggc cttcatgcgc        60
     accggcaatc tggcgcgggc ggcggaggag ttgcagacca gtaacgtcag cgtgcaccgc       120
     gccattcatt cgctggaaag cgcgctgcgt tgcccgctgt tcaagcacga gggacgcaac       180
     ctgacgccac tggaaagcgc gtatgtgctg gaagaacgtg cacagaaact ggtccaggat       240
     gtgctcgcca cggtggaact gacccgtcag gcagcaggct tctcggcggc gcggttcagg       300
     ctgggggcgt tgtactcgct gaccgtcaag acggtgccgc agctgatcat gggcctgaag       360
     atccgccgca gcgagctgaa tatcgacctg attctgggct cgaacatgga cctgctctac       420
     aagctcaaga acatggaagt cgatgcgatg ctggtgtcgc tggatgaaag cacccatgac       480
     ccggactgcg agcatctggc gctgttttcc gacgacatct ttctcgccgt ccccaccgac       540
     tcaccgttcg ccgaacaccc tgaagtggac ctgagcgacc tgcgcgaagc gacgttcatc       600
     accctgaccc aaggcttcgc cacgcaccgc gacgggatcc gcgtattcca gcaggccggt       660
     ttcgagccca aggtggcgat gcaggtcaat gacatcttca ccctgctgag catggtcagc       720
     tccggcgtcg gctatgcact gctgccggga agaatcgccg cggtctatga aaaccgcgtg       780
     cgcctgatcc cgttgcagag ccgctaccgg atgcaacaac acatcggcat tgtttttctc       840
     aagtccaaac agcgcgatcc caacctgctg gcgctgttgg ccgagtgccg gatgtacacc       900
     aaccggctgc tggaacagac gacctga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page