(data stored in ACNUC7421 zone)

EMBL: CP000075.PE458

CP000075.PE458       Location/Qualifiers
FT   CDS_pept        complement(494944..496833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0458"
FT                   /product="Helicase, C-terminal:Type III restriction enzyme,
FT                   res subunit:DEAD/DEAH box helicase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35528"
FT                   /db_xref="GOA:Q4ZZ94"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35528.1"
FT                   /translation="MSFASLGLSEALVRAIEAAGYTQPTPVQQRAIPAVLQGRDLMVAA
FT                   QTGTGKTGGFALPILERLFPNGVPDKSQRHGPRQPRVLVLTPTRELAAQVHESFKLYAR
FT                   DLKFVSACIFGGVGMNPQVQAMSRGVDVLVACPGRLLDLAGQGSVDLSHVEILVLDEAD
FT                   RMLDMGFVHDVKKVLARLPAKRQNLLFSATFSNDITSLAGKLLHNPERIEVTPPNTTVE
FT                   RIEQRVFRLAANHKRSLLAHLITVGAWEQVLVFTRTKHGANRLAEYLDKHGLAAVAIHG
FT                   NKSQNARTKALADFKAGDVRIMVATDIAARGLDIDQLPHVVNFELPNVDEDYVHRIGRT
FT                   GRAGRSGEAISLVAPDEEKLLKSIERMTKQKIADGDLMGFDITAVEAEKPEVRERPDVR
FT                   NSRGARPARGDGDKNNGGRRDKGKDKGKEKPAAASATGERPARQPREKKPREGTPRSEQ
FT                   RASQPATPRPAADRAPDEFRDDEVDNFGNRADYVSPYQGKGQNRGRRPAAAPGAAAPAA
FT                   GGAARPANPGRPAGGARNGSGSGAPKRNGSGSSAPRSRDGQPRGRRPAREDQPLPREGQ
FT                   EPAARAPRDGQPQPKIVHKESKIDRFPSAEQLDQLPSRPRGEKPALLTRNRDS"
     atgtcctttg cttccctcgg tctctccgag gctttagtcc gcgccatcga ggcagccggc        60
     tatacccagc ctacccccgt gcaacagcgg gccattcccg ccgtgttgca aggtcgcgac       120
     ctgatggttg cggcacagac cggtactggt aaaaccggcg gtttcgccct ccctattctg       180
     gagcggctgt ttcccaatgg tgttccggac aaatcccagc gtcacggccc gcgtcaaccg       240
     cgcgttctgg tcctgacccc gacccgcgaa ctggccgcac aggtgcacga gagcttcaag       300
     ctctatgccc gcgacctgaa gttcgtcagc gcctgcatct tcggcggcgt cggcatgaac       360
     ccgcaggttc aggccatgtc ccgtggtgtg gacgtcctgg tggcctgccc tggccgcctg       420
     ctcgacctgg ccggtcaagg cagtgtcgac ctctcccacg tcgaaatcct ggtgctcgat       480
     gaagcagacc ggatgctcga catgggcttc gtgcatgacg tcaagaaggt cctcgcgcgg       540
     ctgccggcca agcgccagaa cctgctgttc tcggctacct tctccaatga catcacgtcg       600
     ttggccggca agctgctgca caacccagag cgcatcgaag tcacgccgcc gaacaccacg       660
     gtcgagcgca tcgagcaacg ggttttccgc ctggcagcca accacaagcg ttcgctgctg       720
     gcgcacctga ttaccgtcgg cgcctgggaa caggtgctgg tcttcacccg caccaagcac       780
     ggtgccaacc gtctggccga gtacctggac aagcacggcc ttgcggctgt cgcgatccac       840
     ggcaacaaga gccagaacgc ccggaccaag gccctggccg acttcaaggc aggcgatgta       900
     cgcatcatgg tcgcgaccga tatcgccgca cgcggcctgg atatcgatca gttgccgcat       960
     gtcgtcaact tcgagctgcc caacgtcgac gaagactacg tgcaccgtat cggtcgtacc      1020
     ggccgtgccg gtcgctctgg tgaagccatt tcgctggttg cgccggacga agagaagctg      1080
     ctcaaaagca tcgagcgcat gaccaagcag aagatcgccg acggcgacct gatgggcttc      1140
     gacatcactg cagtcgaggc tgagaagcct gaagtgcgtg agcgtccgga tgttcgcaac      1200
     tcgcgtggcg cacgtcctgc acgtggcgat ggcgacaaga acaacggtgg tcgtcgcgac      1260
     aagggcaagg ataaaggcaa ggaaaaacct gctgctgcct ccgccactgg cgaacgccct      1320
     gcaaggcagc cacgcgaaaa aaaacctcgt gagggcacgc ctcgcagcga acagcgtgca      1380
     tcgcaacccg ccacaccgcg cccggcagcc gatcgtgccc ctgacgagtt ccgtgacgat      1440
     gaagtagaca actttggcaa ccgcgcggac tacgtcagtc cttatcaggg caaaggccag      1500
     aaccgtggtc gtcgccctgc tgccgcgcct ggcgcagccg caccggccgc tggcggcgct      1560
     gctcgcccgg ccaatccggg tcgccctgcc ggtggcgctc gcaacggctc gggcagtggc      1620
     gcgccaaagc gcaacggctc gggttcatcg gcaccacgct cgcgtgatgg tcagccacgt      1680
     ggccgtcgtc cggcacgtga agaccagccc ttgccacgtg aaggtcagga gccagccgca      1740
     cgcgcaccac gcgacggcca gcctcagccg aagatcgtgc acaaggaatc caagatcgac      1800
     cgtttcccgt ctgccgagca actggaccag ttgccaagcc gcccacgcgg tgaaaaaccg      1860
     gccctgctga cccgcaaccg cgacagctga                                       1890
//

If you have problems or comments...

PBIL Back to PBIL home page