(data stored in SCRATCH zone)

EMBL: CP000075.PE46

CP000075.PE46        Location/Qualifiers
FT   CDS_pept        47937..48227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35120"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35120.1"
FT                   /translation="MTDTPVVITRKRFIAGAVCPACSEPDKLMMWNENDVPHRECVSCG
FT                   YSDTLNEQGISIPKELGTRVNKVVVKPADPKVQGVQFFPNPKLKKPVDLSD"
     atgaccgata caccagtagt cattaccagg aaacgcttca tcgccggggc ggtgtgcccg        60
     gcgtgcagcg agcccgacaa actgatgatg tggaacgaaa acgacgtgcc gcatcgcgag       120
     tgcgtgagtt gcggctacag cgatacgctc aacgagcagg gtatttcgat accgaaggag       180
     ttgggcacac gggtcaacaa ggtggtggtc aaaccggctg atcccaaggt tcagggtgta       240
     cagttcttcc cgaacccgaa gttgaagaag ccggttgatt tgagcgacta g                291
//

If you have problems or comments...

PBIL Back to PBIL home page