(data stored in SCRATCH zone)

EMBL: CP000075.PE464

CP000075.PE464       Location/Qualifiers
FT   CDS_pept        complement(502892..503530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35534"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35534.1"
FT                   /translation="MIDENALRQEICDVGRLLYGRGYTVGSAGNISARLDDGWLITPTD
FT                   ACLGRMDPADIAKVNLAGEWVSGSKPSKTLALHREVYDRNPQVGGVVHTHSTHLVALTL
FT                   AGVWQEDDILPPLTPYQVMKVGHIPLIPYERPGSPKVAERVAELANSVRGVMLERLGPV
FT                   VWESSVAKACYALEELEETARLWLMSNPKPAPLAPAALEELRQVFDARW"
     atgatcgatg aaaacgcact gcgtcaggaa atctgcgacg tcggccgttt gctgtatggc        60
     cgcggctata cggtgggcag cgccggcaac atcagcgcac gactcgacga cggctggctg       120
     attaccccga ccgacgcctg cctggggcgc atggacccgg ccgatatcgc caaggtcaat       180
     ctggccggtg aatgggtgtc tggcagcaag ccgtccaaaa ccctggcctt gcaccgcgag       240
     gtctacgacc gcaatccgca ggtcggtggt gtggtgcaca cgcactcgac gcatctggtc       300
     gccctgaccc tggccggggt gtggcaggaa gacgacattc tgccgccgct gacgccgtac       360
     caggtcatga aggtcgggca tatcccattg atcccttacg agcgtccggg ctcgccgaaa       420
     gtcgccgagc gcgtggcgga actggccaac agcgtgcgcg gcgtgatgct ggagcgcctc       480
     ggtccggtgg tctgggaaag ctcggtggcc aaggcctgct atgccttgga ggagctggaa       540
     gagactgccc gtctgtggct gatgagcaac cccaaacctg caccgctggc cccggcggcg       600
     cttgaagagc tgcgtcaggt gttcgacgcc aggtggtaa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page