(data stored in ACNUC7421 zone)

EMBL: CP000075.PE465

CP000075.PE465       Location/Qualifiers
FT   CDS_pept        complement(503530..504819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0465"
FT                   /product="HopAN1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35535"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35535.1"
FT                   /translation="MSLNNARPLLGCIADDFTGATDLANMLVRGGMRTVQSIGIPSAEM
FT                   AAGLDADAIVIALKSRTTPSAEAVAESLAALEWLRERGCEQIFFKYCSTFDSTAAGNIG
FT                   QVSEALLEQLGSDFTLACPAFPENGRTIFRGHLFVQDQLLSESGMQNHPLTPMTDANLV
FT                   RVLQAQTSHKVGLLRYDSIAQGVEGVRNRIAELRAEGVSMAIADALSDADLYTLGEACA
FT                   DLPLLTGGSGLALGLPGNFRKAGKLRDIDAAKQVAISGGEVVLAGSASVATNGQVAAWL
FT                   EADRPALRINPLELAAGKPVVEQALAFARDAGQTVLIYATSTPDEVKAVQQELGVERSG
FT                   AMVEAALGEIAKGLLDAGVRRFVVAGGETSGAVVQALGVQLLQIGAQIDPGVPATVSSG
FT                   AQPLALALKSGNFGARDFFAKALKQLAGAA"
     atgagcctga ataacgctcg cccgctgctg ggctgcattg ccgatgactt caccggcgcc        60
     accgacctgg ccaacatgct ggtgcggggc ggcatgcgca ccgtgcagag cattggcatc       120
     cccagcgccg agatggcggc cggtctggac gccgacgcga ttgtcatcgc cctgaaatcg       180
     cgtaccacgc ccagcgccga ggcggtggct gaatccctgg ctgctctgga atggctgcgc       240
     gagcgcggct gcgagcagat attcttcaag tactgctcga ccttcgattc cactgctgca       300
     ggtaacatcg gtcaggtcag cgaagcactg ctggagcaac tgggcagcga tttcaccctc       360
     gcctgcccgg ccttcccgga aaacggccgc acgattttcc gtggtcacct gttcgtgcag       420
     gaccagttgc tcagcgaatc gggcatgcag aaccacccgc tgacgcccat gaccgacgcc       480
     aatctggtgc gtgtgctgca agcgcagact agccacaagg tcggcctgtt gcgctatgac       540
     agcattgccc agggcgtcga aggcgtgcgc aacagaattg ccgagctgcg cgccgaaggt       600
     gtgagcatgg cgattgccga tgccctgtcg gatgcggatc tgtacaccct cggcgaagcc       660
     tgcgccgact tgccgctgct gaccggtggc tcggggctgg cgctgggcct gccgggcaac       720
     ttccgcaagg cgggcaagct gcgcgatatc gatgcggcca aacaggtcgc catcagtggc       780
     ggcgaagtgg tactggcggg tagcgcatcg gtcgccacca atggtcaggt cgcggcgtgg       840
     ctggaagccg atcgccctgc gctgcgcatc aatccgctgg agctggccgc tggcaagcca       900
     gtggtcgagc aggcgctggc ctttgccaga gacgccgggc agaccgtatt gatctacgcc       960
     accagcactc cggacgaagt caaagccgtg cagcaagaac tgggcgtcga acgctccggc      1020
     gctatggtcg aagctgcact tggtgaaatc gccaaagggc tgctggacgc aggcgtgcgc      1080
     cgtttcgtgg ttgccggtgg cgaaacctcc ggtgccgtgg ttcaggcact gggcgtgcag      1140
     ttgctgcaaa tcggcgcgca gatcgacccg ggcgttcccg ccacagtgag cagcggcgca      1200
     caaccgctgg ccctggccct caaatccggc aacttcggtg cgcgcgactt cttcgccaag      1260
     gcgctcaagc aactggcggg ggctgcctga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page