(data stored in ACNUC7421 zone)

EMBL: CP000075.PE470

CP000075.PE470       Location/Qualifiers
FT   CDS_pept        complement(510060..510383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35540"
FT                   /db_xref="GOA:Q4ZZ82"
FT                   /db_xref="InterPro:IPR021813"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35540.1"
FT                   /translation="MDFVLDLLATVSRWSRSNLSEIALALVGCLLVLFGSDIKGWLEQR
FT                   ISGITGALRIPLIALLCAVGSGAALIYATPWVVRGLSQFNNYSLAPVLLVVLVLIGVIA
FT                   DRK"
     atggatttcg tactcgactt gctcgccacc gtttcgcgct ggagtcgcag caatctctcg        60
     gaaatcgcgc tcgcgctggt gggctgcctg ctggtgctgt tcggctcgga catcaaaggc       120
     tggctggaac agcgaatcag cggcattacc ggcgccctgc gcatcccgct catcgccttg       180
     ctgtgcgccg tgggcagcgg cgcggcgctg atctacgcca caccgtgggt agtgcgcggc       240
     ctcagccagt tcaacaacta cagcctggca ccggtgctgc tggtggtgct ggtgctgatc       300
     ggggtgattg ccgaccgcaa gtaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page