(data stored in ACNUC7421 zone)

EMBL: CP000075.PE475

CP000075.PE475       Location/Qualifiers
FT   CDS_pept        complement(514265..514855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0475"
FT                   /product="Protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35545"
FT                   /db_xref="GOA:Q4ZZ77"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35545.1"
FT                   /translation="MIGLNTAAIYVLQTLGSLYLLIVLLRFVLQLVRANFYNPLCQFIV
FT                   RATQPLLKPLRRIIPSLFGLDMSSLVLAIIVQMILMALTLLLMFGTTGDPLHLLLWSII
FT                   GVTALFLKIFFFALIISVILSWVAPGSHNPGAELVNQICEPALAPFRKIVPNLGGLDIS
FT                   PILAFLVLKLLDMLVINNLAAMSNMPDVLRLLM"
     atgatcggat tgaacaccgc tgcaatttac gtcctgcaga cgcttggcag tctttacctg        60
     ctgatcgtac tgttgcgctt tgtcctgcaa ctggtacggg ccaacttcta caacccgctg       120
     tgccagttca tcgtgcgcgc cacccagccg ctgctcaagc cgctgcggcg catcatcccc       180
     agcctgttcg ggctggacat gtcgtcgctg gtgctggcga tcatcgtgca gatgatcctg       240
     atggccctga ccctgctgct gatgttcggc accacgggcg acccgctgca cctgctgctg       300
     tggtcgatca tcggcgtgac cgcgctgttc ctgaagatct tcttctttgc cctgatcatc       360
     agcgtgattc tgtcgtgggt cgcaccgggc agccacaacc ccggcgcgga actggtcaac       420
     cagatctgcg aaccggcact ggcaccgttc cgcaagatcg tcccgaatct gggcggcctg       480
     gacatctcgc cgatcctcgc attcctggtg ctcaaactgc tggacatgct ggtcatcaac       540
     aacctcgccg ctatgagcaa catgccggat gtgctgcggt tgttgatgta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page