(data stored in ACNUC7421 zone)

EMBL: CP000075.PE48

CP000075.PE48        Location/Qualifiers
FT   CDS_pept        complement(48668..48898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35122"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35122.1"
FT                   /translation="MMAKYEIRLWAEDIEEHDHPEIAIEFYENDDLQEHAWVRLHPHGK
FT                   HKIRGELGRDEEVLTDLALAFRKKVAELVDW"
     gtgatggcca agtatgagat tcggttgtgg gctgaagaca ttgaggaaca tgaccatcct        60
     gaaatagcca ttgaatttta tgaaaacgat gatttgcaag agcatgcctg ggtcaggctg       120
     caccctcatg gcaagcacaa gattcgcggc gaactgggaa gggacgagga agttctgacc       180
     gacctggcat tggccttcag gaagaaggtg gctgagttgg tggattggta a                231
//

If you have problems or comments...

PBIL Back to PBIL home page