(data stored in SCRATCH zone)

EMBL: CP000075.PE490

CP000075.PE490       Location/Qualifiers
FT   CDS_pept        526311..526850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0490"
FT                   /product="CheW-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35560"
FT                   /db_xref="GOA:Q4ZZ62"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35560.1"
FT                   /translation="MAEPRTAFELLLDMDRRCRSLAAGLPLQEAHQQDWVGIGFRMGEQ
FT                   RFVAPIGEIAEILHEPHHAVMPGVKFWVAGIANLRGRLLPLMDLCGFFGHELVPVRKQR
FT                   RVLVVEHHDVFAGLLVDEVFGMQRFSQLSLIPQTPQEIDQRMVPFLRGQFIREQAWLIF
FT                   SPWALVQSADFMDLAS"
     atggccgagc cgcgcaccgc ttttgaactg cttctggata tggatcgacg ctgtcgttcg        60
     ctggcggcgg gcctgccgct gcaggaagcc catcagcagg actgggtcgg catcggcttt       120
     cgtatgggcg agcaacggtt tgtcgcgccg attggcgaga tcgccgagat ccttcacgaa       180
     ccccatcatg cggtaatgcc cggtgtgaag ttctgggtgg ccggtattgc caacttgcgc       240
     ggtcggttgt tgccactcat ggatctgtgc gggtttttcg gccacgaact ggtgccggtg       300
     cgcaaacagc gacgggtgct ggtggtcgag caccatgatg tatttgccgg tctgctggtc       360
     gatgaagtgt tcggcatgca acgtttcagt cagttgagcc tcatacccca gaccccgcag       420
     gagatcgatc agcgtatggt gccgttcctg cgcgggcagt ttatccgcga gcaggcgtgg       480
     ctgatcttca gcccatgggc gctggtgcag tctgcggatt tcatggacct ggcttcctag       540
//

If you have problems or comments...

PBIL Back to PBIL home page