(data stored in ACNUC7421 zone)

EMBL: CP000075.PE493

CP000075.PE493       Location/Qualifiers
FT   CDS_pept        534962..535432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0493"
FT                   /product="CheW-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35563"
FT                   /db_xref="GOA:Q4ZZ59"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35563.1"
FT                   /translation="MSEGTFQTSRLTSLTGLLVPLSDRHLLLPNVAVAELIDYQDCSAE
FT                   PDAPEWYLGPIIWRELTLPLLSFEAACGGRTRVGGRARIVVLNALGGRNDVRFIALLTQ
FT                   GIPRSCKVDSQLSYVDVPLAELELAAVQIGETIARIPDLEGLEQWLVDAGLS"
     atgtctgaag gcacgttcca gaccagccgt ctgaccagcc tgaccggctt gctggtgccg        60
     ttgagtgacc ggcatctgct gctgcccaac gtcgcggtcg cagagttgat cgattaccag       120
     gattgcagcg cagagccgga cgcccccgag tggtatctgg ggccgatcat ctggcgcgaa       180
     ctgaccttgc cgctgctcag cttcgaagcc gcctgcggag gccgcacccg tgtcggcggc       240
     cgagcccgga tcgtggtgct caacgcactg ggcggacgca acgacgtcag gttcatcgcc       300
     ctgctgaccc agggcatccc gcgctcgtgc aaggtcgaca gccagttgag ctacgtcgac       360
     gtcccgctgg ccgaactgga actggccgcc gtacagatcg gcgaaaccat agcccgtatt       420
     cccgacctcg aagggctgga gcaatggctg gtggatgcag ggctgtcgta g                471
//

If you have problems or comments...

PBIL Back to PBIL home page