(data stored in ACNUC7421 zone)

EMBL: CP000075.PE499

CP000075.PE499       Location/Qualifiers
FT   CDS_pept        540894..542498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0499"
FT                   /product="Urea amidolyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35569"
FT                   /db_xref="GOA:Q4ZZ53"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35569.1"
FT                   /translation="MRFYPANLDALLVELSNLDETLALFESLQQMPIAGVEEIVPAART
FT                   LLVHFRPSAIGFEALATQIASRDIRGKAREAGKLIEIPVHYNGEDLADVARELDISVEE
FT                   VIKRHTSSDYNVAFCGFAPGFAYLSGGAGFVVPRRSTPRTRIPAGAVALAGGFSGIYPQ
FT                   ASPGGWQIIGVTTSTMWDLGRDEPALLQPGYRVRFQDAGPLPETRVQVAAPVRPQATTV
FT                   SEDYLQIETPGLQTLFQDLGRPGRAGQGVSASGALDRGALRAANRAVGNDPATACLEIL
FT                   MGGLTFTCQGQTVVAITGAQVSVEVLTAEGQKLRPLLYAPFSLQNGDQVSIGSPTAGLR
FT                   NYLAVRGGFIHEPVLGSLSTDTLAQVGPAALAAGDRLGFTRRTGGLSVSTAEQPAFEMP
FT                   RSDEVITLDVVMGPRSDWFSAEAQQLLAQQTWLVTPQSNRIGIRLAGEQSLQRAVDGEL
FT                   PSEGTTVGAIQVPPSGQPVLFLADHPLTGGYPVIGAVATYHLDKAGQIPVNARIRFNPL
FT                   SAFEPVRPATSDETKNR"
     atgcgtttct acccggccaa cctggatgca ctcctggttg aactgtcgaa tctggacgag        60
     accctggccc tgttcgaatc gttacagcag atgcccatcg ctggcgtgga ggaaatcgtc       120
     ccggccgccc gaacgttgct ggtgcatttt cgtccgtcag ccatcggttt cgaagcactg       180
     gccacacaga tcgcctcgcg cgacattcgt ggcaaggcgc gcgaggcggg caagctgatc       240
     gaaataccgg tgcattacaa cggtgaagac ctggccgatg tcgcccgcga gctggacatc       300
     agcgtcgagg aagtcatcaa gcgccacacc agcagcgact acaacgttgc gttctgcggc       360
     tttgcgcccg gttttgccta cctcagcggc ggcgccgggt tcgtggtgcc acggcgcagc       420
     acgccgcgca cgcgtattcc ggctggcgca gtggcactgg ccggtggttt cagtggtatt       480
     tacccacagg ccagccccgg cggctggcag atcatcgggg tgaccacctc aaccatgtgg       540
     gacctgggcc gcgacgagcc cgccttgctc cagcccggct accgcgtgcg tttccaggat       600
     gccggtccgc tcccggagac tcgtgtgcag gttgccgcac ctgtccggcc gcaggcgacg       660
     acggtcagcg aagactatct gcagatcgag acgccaggtc tgcagaccct gtttcaggac       720
     ctggggcgtc ccggtcgcgc ggggcagggt gtttccgcat cgggcgcgct ggatcgcggc       780
     gccttgcgcg ctgccaaccg cgcggtgggt aacgatccgg cgacggcgtg cctggaaatt       840
     ctcatgggcg gcctgacctt cacctgtcag gggcagaccg ttgtggcgat taccggggct       900
     caggtcagcg tcgaggtgct gaccgccgaa gggcaaaaat tgcggccgct gctttatgcg       960
     cctttttctc tacagaacgg cgatcaggtc agcatcggtt ccccgactgc cggcctgcgc      1020
     aattatctgg cggttcgtgg cggtttcatt catgagccgg tgctcggcag cctgtccacc      1080
     gacacgctgg cccaggtcgg gcccgccgcg ttggcagcgg gtgaccggct gggcttcacg      1140
     cgcagaaccg gcggcctttc agtatcgact gccgaacaac cggccttcga gatgccgcgt      1200
     agcgatgagg tcatcaccct ggatgtggtc atggggccgc gcagtgactg gttcagcgcc      1260
     gaagcacagc aactgctggc gcaacagacc tggctggtca cgccgcaatc caaccgtatc      1320
     ggcattcgcc tggcgggcga gcaatcgctg caacgtgccg tcgatggcga gttgcccagc      1380
     gagggcacca cagtcggcgc cattcaagtg ccgcccagtg gccagccggt gctgtttctg      1440
     gccgatcacc cgttgaccgg tggttatccg gtcatcggcg cagtcgccac ctaccacctg      1500
     gacaaggccg ggcagattcc ggtcaatgcc cgcattcgct tcaacccgct gagcgccttc      1560
     gagccagtgc gccccgccac ttcagacgag accaagaaca gatga                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page