(data stored in ACNUC7421 zone)

EMBL: CP000075.PE5

CP000075.PE5         Location/Qualifiers
FT   CDS_pept        complement(6282..7169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35079"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q500U3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35079.1"
FT                   /translation="MQRLNLVARSVLASSTMLCWSTVTHALEITAGDYEPLPVGMNALL
FT                   VYAQHAESSDFYSNGQKVSDDFRLKTDVSLLRYIHSFALSNNAVIEPQFILPYGHLKAG
FT                   GEASALGQTTGAGDLILGAPVKWTLATANKDVFSVAPYLYLPTGSYENDDTLNLGENRW
FT                   RLLLQAAYIHHFNARWALDTAADVSWFSDNDDYGSGSDTLAQKTRYEYQAYLSYNVSPQ
FT                   TRFAVGGGHIDGGENRVGGVNQDDQLSTTYLRVSATHMLTPSIQVQAVLGRDVEVEEGF
FT                   REKSRLNLRLAKLF"
     atgcaaagac tcaatctggt tgcccgttca gtgctggcca gctctaccat gctgtgttgg        60
     tcgaccgtga ctcatgccct ggaaatcacc gcaggcgatt atgagccgct gcctgtcggc       120
     atgaacgctt tgctggttta tgcacaacac gctgaaagct cggactttta cagcaacggt       180
     caaaaagtct cggacgattt tcggctcaag accgatgtca gcctgcttcg ctatatccac       240
     tcgtttgcgc tgagcaacaa cgcggtgata gagccacagt tcatcctgcc ttatggacat       300
     ctgaaggctg gtggtgaggc aagcgcgctt ggccagacca ccggcgccgg agatctgatt       360
     ctcggcgcac cggtaaagtg gaccttagcc actgcaaata aggatgtctt ttccgtggcg       420
     ccttaccttt atttgcctac cggcagttac gaaaacgacg acacactcaa cctgggtgaa       480
     aaccgctggc gtcttttgct gcaagcagcc tacatccatc acttcaatgc cagatgggct       540
     ctggacaccg ctgcggatgt ctcatggttc agcgataacg atgattacgg ttcaggcagt       600
     gacacattgg cacagaagac ccgctacgaa tatcaggctt acctgagcta caacgtttca       660
     ccgcaaaccc ggtttgccgt tggtggaggc catattgatg gcggagaaaa ccgggtgggt       720
     ggcgtcaatc aagacgatca actgagcact acctacctgc gtgtgagtgc cactcacatg       780
     ctgaccccgt cgattcaggt ccaggccgta ctcggcaggg atgtagaagt ggaggagggc       840
     ttccgggaaa agtcccgctt gaatctgcga ctggcgaaac tgttttag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page