(data stored in SCRATCH zone)

EMBL: CP000075.PE500

CP000075.PE500       Location/Qualifiers
FT   CDS_pept        542495..544228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0500"
FT                   /product="biotin carboxyl carrier protein / biotin
FT                   carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35570"
FT                   /db_xref="GOA:Q4ZZ52"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35570.1"
FT                   /translation="MKKVLIANRGEIAVRIARACRDYGVASVAVYADADIDALHVRQAD
FT                   EAYGLQGERPTDTYLNIEKLLAVAARAGADAVHPGYGFLSERAEFARAVIDAGLIWIGP
FT                   DPATIDALGDKVQARRIALKVGAPLVAGTEDPVNDASEVVAFAEQHGLPIAIKAAFGGG
FT                   GRGLKVAWKLDEVSELYESAVREALTAFGRGECFVERFLDRPRHIEAQIIADRHGRVVV
FT                   VGTRDCSLQRRNQKLIEEAPAPYLNDELRQRIHESARAVCAEAGYVGAGTVEFLLSGDG
FT                   TLSFLEVNTRLQVEHPVTEETSGVDLVIEQLRVADGLPLSFDGTPVPRGHSFEFRINAE
FT                   DAGNGFLPTPGSITLFQPPSGPGVRLDTGVAEGSRVSPNFDSMIAKLIVTGATREQAIS
FT                   RARRALAEFKVEGVATVLPFHRAVMDHADFTAANTFAVHTRWIETDFAEHVTIAPRNAE
FT                   PVDPGVLRTFVEIDGKRHELGLPAELLAGMSLNAAAPADASQPVADAPDPHAVLTPVAG
FT                   NLHAWAVEDGATVEKGQVIAIMEAMKMETSILAPCAGTVQIGKEPGGYLEAKVVIGRVE
FT                   A"
     atgaaaaagg ttctgatagc caatcgtggc gaaattgccg ttcgtattgc ccgtgcctgc        60
     cgtgactacg gagtcgcctc ggtggcggtg tacgccgatg ccgatatcga cgcgctgcac       120
     gtgcgtcagg ccgatgaggc ctacggactg cagggcgagc gcccgaccga cacctacctg       180
     aacatcgaaa agctgctggc ggttgccgcg cgtgccggtg ccgacgcggt tcacccaggc       240
     tacggcttcc tctcggagcg cgccgaattc gcccgcgcgg tgatcgacgc cggtctgatc       300
     tggatcggcc ccgatcctgc gaccatcgac gcactgggcg acaaggtcca ggcccgacgt       360
     atcgccctga aagtcggcgc acccctggtg gccggtacgg aagacccggt aaacgatgcc       420
     tctgaggtgg tcgcatttgc cgagcagcac ggcctgccga ttgccatcaa ggctgccttt       480
     ggcggcggtg ggcgcggcct gaaagtcgcc tggaagctcg atgaagtcag cgagctgtac       540
     gaatctgcag tgcgtgaggc gttgaccgcg ttcggtcgtg gcgagtgctt cgtcgagcgc       600
     ttcctggatc gcccacggca catcgaagcg cagatcatcg ccgaccgtca tggccgggtg       660
     gttgtggtcg gcacccgtga ctgctcgttg cagcgtcgca accagaagct gatcgaagaa       720
     gcgccagcgc cttatctgaa tgacgaactg cgccagcgca ttcacgagtc ggcccgcgcg       780
     gtctgcgccg aagcgggcta tgtcggtgcc ggtacggtgg agttcctgct cagcggcgat       840
     ggcaccctgt cgttcctgga ggtcaacacg cgcttgcagg tcgaacaccc ggtgacggaa       900
     gaaaccagcg gtgtggacct ggtcatcgaa caacttcgcg tcgccgacgg cctgccgctg       960
     tcgttcgatg gcacgcctgt gccgcgcggt cacagctttg aattccgcat caatgccgaa      1020
     gacgcgggca acggctttct gccgacgccg gggtctatca ctttatttca gccgccgtcc      1080
     ggtccgggcg tgcgtctgga caccggcgtg gcagaaggct cacgggtttc accaaacttc      1140
     gactcgatga tcgccaagct gatcgtcacc ggcgccaccc gcgaacaggc catcagccgc      1200
     gcccgccgtg cgctggccga gttcaaggtg gaaggcgtgg ccaccgtgct gccgttccac      1260
     cgggcggtca tggaccatgc cgacttcacc gcggccaata ccttcgccgt ccacacccgc      1320
     tggatcgaaa ccgacttcgc cgagcacgtc accatcgccc cacgcaacgc agagccggtc      1380
     gatcccggcg tgttgcgcac cttcgttgaa atcgacggca aacgccacga actgggcctg      1440
     cctgctgagc tgctggccgg catgagcctg aacgctgccg ccccggctga cgccagccag      1500
     ccagtcgccg atgccccgga cccgcacgcc gtgctgacgc cggtagcggg caacctgcat      1560
     gcctgggcgg ttgaagacgg tgcgacggta gaaaagggac aggtgatcgc catcatggag      1620
     gcgatgaaga tggaaacatc gatactggca ccgtgtgccg gaaccgtgca gatcggcaag      1680
     gagcctgggg ggtatctgga ggcgaaggtg gtgattgggc gggttgaggc ctga            1734
//

If you have problems or comments...

PBIL Back to PBIL home page