(data stored in SCRATCH zone)

EMBL: CP000075.PE503

CP000075.PE503       Location/Qualifiers
FT   CDS_pept        549707..552841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0503"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35573"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35573.1"
FT                   /translation="MDDEFAAHYDFDDADRAGDDDSDAAFRKRVDEDFSVSDYFRLNPI
FT                   NLQSPAALAARDVAQECQSRWGVEIDPDDTLIATLYIEDPRLYPAPHRANVVHSMTLTQ
FT                   ALLRNWQQKGNGNWFDHLGHLQPHSDGGFDCQVVDEKLLASDCVAYEAIYRKTSPQRYD
FT                   ATTQLGINAEAFKQYIWDHNLQSGYIAYLKQFWHAHGEDYNLMLKAGLFKAAWLQADEN
FT                   TLKAEHKAMVLEALGLPGDQGWKTLSFDDFVAAPIATRVTISELLVHGYSAVDIMVIRS
FT                   ADSPTVLLYIPGNSSPIHAFKNADELKEWVALMCRDPGKRRSLEAHFSAADDLDGFFYS
FT                   GVATALKGFAVYPKLLDSATGAWNPRKLVQFGEPLQPWPFSHFKTRVRAKSEIDALQKI
FT                   RSHGDYWKEEASSGLSECVSVLGGVAIVFPELMPVVAGLSLALVGLGVDAAVNGHTLEE
FT                   RQAGLGRIAFGVLNALPILGEEGEAVEAGVETGLVDETGGGYEVPGASTEIDPVIDIEP
FT                   APVFRPEPPALRSLDKKMRRLLRALEAPQELPGLASGEVAGIYPLEGKRYIELHDRAFR
FT                   VEWVPQEKQYRIRSAADPRVWGPYVKTVDTGYWDLDLKLGLRGGESFDGTQLPPASEAE
FT                   SVVVPVVPGEPKIEVQRWAPKLQVELPMDGISIEEVLSQSRGTVIEKYFVQVRGEKTNV
FT                   YYDPDIRCWRTDPSDRDGLVWLDRDGVWNRGSKDTFQKLEANLPQSQRFEFYTFPRVPS
FT                   LPADAKPISRIVHHIWMGERTPGADLLEKMLSNMRTSPDLRFQLHIDIDDPAADQQLFD
FT                   YFFEQPQMHISRLKEEAFYPDFLSGENGEAFNYFRHSDNRNYAAASDILRYRLIDEYGG
FT                   IYVDCDDTINVPFAKFPLKAGPNDVLLGRELQAEHLGYKGPGNSHFGSHPNNPVLKQML
FT                   KEIKVRFDSEKQINEAFFSTRRPYIDRTDDATKAASKARMTPYMTRISDLTGPKLMSDV
FT                   LRRLRPDCFDLLARSYLPPDQVLSVIYEAYLKDTVDFYFPFKATAKITPGSANEW"
     atggatgatg agtttgcagc acattacgac ttcgacgatg ccgacagggc tggcgatgat        60
     gactctgacg cagcgttccg gaaacgggta gacgaagact tttcggtcag cgattacttc       120
     cggctcaacc cgatcaacct gcagtcacct gccgccctgg ctgcgcgtga tgtggcacag       180
     gaatgccagt cgcggtgggg cgtcgagatt gatccggacg acaccctgat cgccactctg       240
     tatatcgaag atccgaggct ctaccccgca cctcaccgcg ccaatgtcgt tcactcgatg       300
     acactgaccc aggcgctgct gcgtaactgg cagcaaaagg gcaatggcaa ctggtttgat       360
     cacctcgggc atttgcaacc ccacagtgat ggcggtttcg actgccaggt cgtggacgag       420
     aagctgctcg cttccgactg cgtcgcttac gaggccatct accgaaaaac cagcccgcag       480
     cgctatgacg caacgacaca acttggcatc aatgccgagg cattcaagca atacatctgg       540
     gatcacaatc tgcaatcagg gtatatcgct tatctgaagc agttctggca cgcgcatggc       600
     gaagactaca acctgatgct aaaggccggg ttgttcaagg cagcctggct gcaagccgac       660
     gaaaataccc tcaaggccga gcacaaggcc atggtacttg aggcgcttgg cctgcccggc       720
     gatcagggct ggaaaacgct gagtttcgac gattttgtcg ctgccccgat tgccacccgt       780
     gtgacgattt ccgagctgct ggttcacggt tacagtgccg tcgacatcat ggtcatacgc       840
     agcgccgatt cgccgaccgt gctgctctat atacccggta attcgtcacc cattcatgcc       900
     ttcaagaacg cagacgaact caaggaatgg gtcgcgctga tgtgcaggga ccccggcaag       960
     cgccgttctt tggaggcgca cttcagtgct gccgatgacc tggatggctt tttctacagt      1020
     ggtgtggcca ctgccctgaa aggctttgcc gtctacccga agctgctgga ctccgcgacg      1080
     ggggcatgga acccccgaaa gctggtgcag tttggcgaac ctctgcagcc ctggccgttc      1140
     tcgcacttca agactcgggt cagggcaaag tccgaaatcg atgcgctgca aaaaatccgc      1200
     agccatggcg actactggaa agaggaagcc agcagcggtt tgagcgaatg cgtgtccgtt      1260
     ctgggtggcg ttgccatcgt ctttcccgag ctgatgccgg tggtcgcagg gctgtctctc      1320
     gcgctggtcg ggttgggtgt tgacgccgcc gtgaatggtc acacgctgga ggagcgtcag      1380
     gctgggcttg ggcggattgc cttcggcgtc ttgaacgcgc tgccgattct cggcgaggag      1440
     ggtgaggcgg tcgaggccgg agttgaaaca gggctggttg acgagacggg tggcggctat      1500
     gaggtgccag gggcatcgac tgagatcgac cctgtcatcg atattgagcc agccccggtt      1560
     ttcaggccgg aacccccggc actgcgctcg cttgacaaga aaatgcgccg cctgttgcgc      1620
     gcgcttgaag cgcctcagga actgccggga cttgcgtcgg gcgaagtggc gggtatctat      1680
     ccgctcgaag gcaaacgcta catcgaactg catgatcgtg cgttccgggt ggagtgggtg      1740
     ccgcaggaga aacagtaccg aattcgctcc gccgcggatc ctcgtgtgtg ggggccctat      1800
     gtgaagactg tcgacaccgg ctactgggac ctggacctca agctggggct gcgcggcggg      1860
     gaaagtttcg acggtacgca gttgccgcct gccagtgaag cagaaagcgt cgtagtaccg      1920
     gtggtgcccg gcgagccgaa aatcgaagtc cagcgctggg cccccaagtt gcaggtcgaa      1980
     ttgcctatgg acggtatcag catcgaggag gtactgagtc aatcaagagg gaccgtcata      2040
     gagaagtatt tcgttcaggt gaggggggaa aagacgaatg tctattacga ccccgatatt      2100
     cgttgctggc gaactgaccc atctgacagg gacggcttgg tgtggctgga tcgcgacggg      2160
     gtgtggaacc gcggttccaa agacacattc cagaaacttg aggcaaatct gccacagagc      2220
     cagcgtttcg agttctatac ttttcctcgt gtaccgagcc tgccggcaga cgccaaaccc      2280
     ataagccgca tcgttcacca catctggatg ggggaacgaa cgccgggtgc agacctcctg      2340
     gaaaagatgc tgagcaacat gcgcaccagt ccggatttgc gctttcaact gcacatagat      2400
     atcgatgacc cggcagctga ccagcagttg ttcgattact tttttgaaca gccgcaaatg      2460
     catatttccc gcctcaagga agaagcgttc tatccagact tcctgagcgg cgaaaacggc      2520
     gaggcattca attacttcag gcactcggat aaccgtaatt acgccgctgc ctcggatatt      2580
     ttgcgctatc gactgattga cgagtatggc ggtatctatg tcgattgcga cgacacgatc      2640
     aacgtccctt tcgcaaaatt tccattgaaa gccggtccga atgacgtact gctgggaagg      2700
     gaactgcagg cggagcatct gggttataaa gggccgggaa acagtcactt cggcagtcac      2760
     ccgaacaatc ctgttttaaa acagatgctc aaggagataa aggtacgctt cgacagcgag      2820
     aagcagatca acgaagcgtt cttcagtacc cgcaggccct acatcgaccg taccgacgac      2880
     gccacgaaag ccgcatcaaa agccaggatg acgccttata tgacacgtat ttcggacctg      2940
     accggcccca agctgatgtc agatgttttg cgaaggctgc gacctgactg cttcgatttg      3000
     ctggcgcgct cctatcttcc gcctgatcaa gtcctgtccg tcatatacga ggcctatctg      3060
     aaggataccg tggacttcta tttccccttc aaggccacgg cgaagattac tccaggctct      3120
     gcgaatgagt ggtag                                                       3135
//

If you have problems or comments...

PBIL Back to PBIL home page