(data stored in ACNUC7421 zone)

EMBL: CP000075.PE504

CP000075.PE504       Location/Qualifiers
FT   CDS_pept        552941..555589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0504"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35574"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35574.1"
FT                   /translation="MTSLTQEDVMSPPPSQASKTDQQLLRERAQQFVLDYPDLHDLAYI
FT                   AASKIILQHTHRMFNPEKVYWHRFGSASSSPRTFTGWQHSGKPVQSMTLIELLIKHFSA
FT                   HDQEASDELSLYGGFYTDGPDHGFFDERNEVPMLPQDVLNDMWTLDFSSLYSRRMERFW
FT                   NTHSDNFCILAKAQYLVAAGHCLRKGQLSPDDFKQVTRVVIADPLQTPTLKALQEPLPL
FT                   PPGVSVHTLDIDGIKAHDLLRIVIAGGREVIYWPDAEQPFMAFDSERALYHWLKEQFMG
FT                   EQAAKAMTGHFLRGEASRTQDGARFARAVSDLLAHDWRADVRLINQSQAPIAGDPFVYL
FT                   RDVARQAMSADAREILTSNTDLLKQIWIGYLSAFLRAFGGLAPLSWPVALTLVGASLAN
FT                   TGLNIDQAVNGKTPAQRKAGVLGAILNTLYLLFNLPLLMSIRVAPQPLQVTTTDVASIS
FT                   SEALEGGSVLADPLDNMEGNLLLDTLTPSAEEGRLRGVYTLGNGETWIKLAHLPYRVMF
FT                   NEQQQCWMVVNPDNPFAFIGSKPVRLNAEGKWTLMASPGLQGGSPMDVQIPSGSASAPV
FT                   GKPYATVGSSFWDRYLQTDIFNEQHFAETALARQKQVMSIWDATPEDVLESDSSPDGNE
FT                   VYRDPWQGKHRVFKLGDDDYYAANITLYTQDDAQFNRFLRTGESLGRNQVRAIERLADD
FT                   IHVVGYNNDVELYRGGSGDRGTSGAVFRSGQIKVGDVLVNTDVTSFSENPYVVSAFASS
FT                   RAGAPASAMLGPVTFDDTSVVFVLPKGRYLRATPVAPFSASPDEAESIFLPGCYFQIDS
FT                   IEEVSGEFYRIMKVQMQEVDRPIQGRALYDMRTGEPFSREQYALKLGTDAKVLVDRFFP
FT                   QNPMTDLFSPR"
     atgacttctc tcacacagga agacgttatg tcacccccac cctcgcaagc ctccaaaacc        60
     gatcagcaac tgctgcgcga acgtgcgcag cagtttgttc tcgactatcc cgatctgcac       120
     gatctggcct atatcgcagc cagcaagatc attcttcaac acacccacag gatgttcaat       180
     cctgaaaagg tgtactggca tcgtttcggt tccgccagca gcagcccgcg taccttcacc       240
     ggctggcagc attccggaaa gcctgtgcag tcgatgacgt tgatcgagct gctcattaag       300
     cacttcagcg cccacgacca ggaagccagc gatgagctct ccctgtacgg tggtttttat       360
     accgatggcc cggaccacgg gtttttcgac gagcgcaatg aggtgcccat gctgcctcag       420
     gatgtgctca acgacatgtg gacgcttgat ttcagttcgt tgtacagccg ccgaatggag       480
     cgcttctgga acacccacag tgacaacttt tgcattctgg ccaaggcgca atatctggtt       540
     gccgccggcc attgcctgcg caagggccaa ctgtcacccg acgacttcaa acaggtcacc       600
     cgcgtcgtta ttgccgatcc attgcaaacg cctacgctga aagcgttgca ggagccgctg       660
     ccgttgccgc ccggtgtgtc ggtacatacg ctggatatcg acggcatcaa ggcccacgac       720
     ctgctgcgta tcgtcattgc cggtgggcgg gaggtgattt actggcctga tgccgaacag       780
     ccttttatgg cgttcgacag cgagcgcgcc ttgtaccact ggctcaagga acagttcatg       840
     ggcgagcagg cagccaaggc gatgacaggc catttcctgc gtggtgaggc gtcccggaca       900
     caagatggcg ccaggtttgc gcgcgcggtg agcgatttgc tcgcgcacga ttggcgtgct       960
     gacgttcgac tcatcaacca gtcgcaagcg cctattgcag gggatccctt tgtttacctg      1020
     cgtgacgttg cccggcaggc aatgagcgcc gatgcacgcg agatcctgac gtccaatacc      1080
     gacctgctca agcagatatg gatcggctat ctgagcgcat tcctgcgggc gtttggcggg      1140
     cttgcgccgc tgagctggcc ggttgctttg acgcttgtcg gggcaagtct tgccaatacc      1200
     gggttgaata ttgatcaggc ggtcaatggc aaaacccctg cgcaacgcaa ggctggtgtg      1260
     ctgggcgcga ttctcaacac gctttatcta ctcttcaatc ttcctctgct gatgtccata      1320
     cgtgtcgctc cccagccttt acaggtaacg acaacggacg tcgcatcgat ctccagtgag      1380
     gccctggagg gcggcagcgt gcttgccgac ccgctggata acatggaagg caacctgctg      1440
     ctcgacaccc tcacgccctc agccgaagag ggcaggttgc gcggcgtcta cacgctgggt      1500
     aacggcgaaa cctggatcaa gctggcgcac ttgccttatc gcgtaatgtt caatgagcaa      1560
     cagcagtgct ggatggtcgt caatcctgat aacccgtttg cgttcatcgg cagcaagccg      1620
     gttcgtctga acgccgaagg gaaatggacg ctgatggcgt cgcccggctt gcagggcggc      1680
     tctcctatgg atgtgcagat tccgtcaggc agcgcatctg ccccggttgg caaaccttat      1740
     gcgacagtag gttcctcgtt ctgggaccgg tatttgcaaa ctgacatttt caatgagcag      1800
     cactttgcag aaacagctct ggcccggcag aaacaggtca tgtcaatctg ggacgcgacc      1860
     ccggaggatg tcctggagtc cgattcttcg cccgatggca acgaggtata cagggacccc      1920
     tggcagggca aacatcgggt tttcaagctt ggtgatgacg actattacgc cgccaacatc      1980
     acgctgtata cccaggatga tgcgcaattc aacaggttcc tgcgtaccgg tgagagcctg      2040
     ggccgaaacc aggtcagagc catcgaacgc ctggccgatg acatccatgt ggtggggtac      2100
     aacaatgatg tcgagttgta ccgtggcggc agtggtgatc ggggcacctc gggtgccgtg      2160
     ttccgcagcg ggcagatcaa ggtcggcgac gtgctggtca ataccgatgt cacctcgttc      2220
     agcgaaaacc cctatgtggt cagcgccttt gccagcagtc gggccggtgc gcccgctagc      2280
     gccatgcttg ggccggtcac gttcgatgac acctcggtgg tcttcgtttt gcccaaaggg      2340
     cgttatctgc gggccacgcc tgttgcgcca ttctcggcct cgcccgatga ggccgaatcg      2400
     atcttcttgc ccggatgcta ctttcagatc gacagcatcg aagaagtgag cggtgagttt      2460
     tatcgcatca tgaaagtcca gatgcaggag gtcgatcgtc caatccaggg gcgggcgctt      2520
     tacgatatgc gcacgggcga gccattcagt cgagagcagt acgcgcttaa gctggggaca      2580
     gatgccaagg tactggtcga ccggtttttt ccgcagaatc caatgacaga cctgttcagc      2640
     ccgcgctga                                                              2649
//

If you have problems or comments...

PBIL Back to PBIL home page