(data stored in SCRATCH zone)

EMBL: CP000075.PE51

CP000075.PE51        Location/Qualifiers
FT   CDS_pept        complement(51865..52458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35125"
FT                   /db_xref="GOA:Q500P7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35125.1"
FT                   /translation="MDMLGLPVSAYWLEPLLVGAQILLILLAGYVLQRIVGGFLTGLGE
FT                   RYPLPPELLVPVRGGLRWLIMGSAFVLVLGRLGVSATVLWTALSGFVAVAAVAFFAMWS
FT                   VLSNLLCAILIFTIGPFRIGDMVELVDTLDKPGVKGRVVAINLMFTTLIETPEAGGALV
FT                   QVPNSQFFQKSVRRWRGSDLFPQMVVAKQPDEQD"
     atggacatgt tgggcttgcc ggtatccgcg tactggcttg aaccgctgct ggtgggtgcg        60
     cagattctgc tgatcctgct ggccggttac gtactgcaac gcatcgtggg tggttttctg       120
     accgggctgg gcgagcgcta tccgttgccg ccagaattgc tggtgccggt tcgcggaggc       180
     ctgcgctggt tgatcatggg cagcgccttt gtcctcgtcc tgggtcgact cggggtgtcg       240
     gccacggtgc tgtggactgc actgtccggc ttcgtcgccg tcgcggcggt ggcgttcttc       300
     gccatgtgga gcgtgctgtc gaacctgctc tgcgccattc tgatcttcac catcggcccg       360
     ttccgcatcg gtgacatggt cgagctggtc gatacgctgg acaagccggg cgtgaagggc       420
     agggtggttg ccatcaacct gatgttcacc accctgatcg agaccccgga agccggtggt       480
     gcgctggtcc aggtgcccaa cagccagttt ttccagaagt cggtgcgccg ttggcgtggc       540
     agcgatctgt ttccgcagat ggtggtcgca aagcagccgg acgagcagga ttag             594
//

If you have problems or comments...

PBIL Back to PBIL home page