(data stored in ACNUC7421 zone)

EMBL: CP000075.PE514

CP000075.PE514       Location/Qualifiers
FT   CDS_pept        complement(569076..571274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0514"
FT                   /product="Intergral membrane protein, YccS:Integral
FT                   membrane protein, YccS/YhfK"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35584"
FT                   /db_xref="GOA:Q4ZZ38"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35584.1"
FT                   /translation="MASKSLRHTFRRLWALDKFSYSVRVFIALTGSMALCWYQNEMALL
FT                   IPLFLGIIACALAETDDSWQGRLNALAVTLVCFSIAALAVELLFPYPILFVCSLALASF
FT                   CLTMLGALGERYGAIAYGTLILSVYTMIGVDQRGGEVLDFWHEPMLLVAGAAWYGLLSV
FT                   LWQMLFSNQPVQQALARLFRELGQYLKLKSTLFEPIRTLNVEARRLELAQQNGKVVAAL
FT                   NSTKEIILHRVGSGRPGSKVSRYLKLYFIAQDIHERASSSHYPYNSLADAFFHSDVLFR
FT                   CQRLLRQQGVACQALSESIQLRQPFVYDPSFAEAMEDLHASLEHLRIQSNPAWRGLLRS
FT                   LRALAANLGTLDRLISDASNPDAVADATDSSLLDRSPRNLKDVWTRLRLQMTPTSLLFR
FT                   HALRLPLALTIGYAMVHLIHPSQGYWIILTTVFVCQPSYGATRLKLGQRIIGTAIGLTV
FT                   GWVLFDLVTSPILQSMCAVLAGVVFFVNRTTRYTLSTAAITVMVLFCFNQVGDGYGLFL
FT                   PRLFDTLLGSLIAGLAVFLFLPDWQGRRLNKVLANTLTCNSIYLRQIMQQYAKGKSDDL
FT                   AYRLARRNAHNADAALSTTLANMLMEPGHFRKEADVGFRFLVLSHTLLSYLSGLGAHRD
FT                   TQLPSDVREHLIDNVGATLAASIDEIAAGLAEKKPVAVQSDAEEGLAAQLEQLPEDMDE
FT                   SQRLVQAQLALICRQLAPLRTLAAHLIKAPEVAATHAV"
     atggcatcga aatctctccg tcatacattc cgtcgattgt gggcgctgga taaattcagc        60
     tatagcgttc gagtctttat cgcactgacc ggcagcatgg cactgtgctg gtatcaaaat       120
     gaaatggcgt tactgatccc gctgtttctg gggattatcg cctgcgccct ggccgagacc       180
     gacgacagct ggcagggccg actcaacgca ctggccgtga cactggtgtg tttcagcatc       240
     gccgccctcg ccgtcgaatt gctcttcccc taccccatcc tgtttgtctg ttcactggcg       300
     ctggccagct tctgcctgac catgctcggc gcactgggtg aacgctatgg cgcgattgcc       360
     tacggcacgt tgatcctttc ggtctacacc atgatcggcg tcgatcagcg tggcggtgaa       420
     gtactggact tctggcacga accgatgctg ctggtggcgg gcgcagcctg gtacggcctg       480
     ctgtcggtgc tctggcagat gctgttctcc aaccagccgg tgcaacaggc gctggcgcga       540
     ctgtttcgtg agctgggcca gtacctgaag ctcaagtcga ccctgttcga accgattcgc       600
     acgctcaacg tggaggcccg tcgcctggag ctggcgcagc agaacggcaa agtcgtcgcc       660
     gcgctgaact ccaccaagga aatcatcctg caccgcgtcg gcagcggccg ccccggctcc       720
     aaggtcagcc gctacctgaa gctgtacttc atcgcccagg acatccacga gcgcgccagc       780
     tcgtcgcatt acccctacaa ctcactggcc gatgcgtttt tccatagcga cgtgctgttc       840
     cgctgccagc gcctgctgcg tcaacagggc gtcgcctgcc aggcgctgtc ggaatccatc       900
     cagttacgtc agccattcgt gtatgaccca agcttcgccg aagccatgga agacctgcac       960
     gcgtcccttg aacatctgcg catccagagc aaccctgcgt ggcgcggcct gctgcgttcg      1020
     ctgcgcgcgc tggccgccaa ccttggcacc ctggatcgcc tgatcagcga cgccagcaac      1080
     ccggacgccg tggccgatgc caccgacagc agcctgctgg accgctcgcc gcgcaacctc      1140
     aaggatgtct ggacgcgcct gcgcctgcag atgaccccga cctcgctgct gtttcgtcac      1200
     gccctgcgcc tgccgctggc attgaccatc ggttacgcga tggtgcacct gattcacccg      1260
     tcacagggct actggatcat cctgaccacg gtgttcgtct gccagcccag ctacggcgcc      1320
     acccggctca agctcggcca gcggatcatc ggcaccgcga tcggcctgac ggtcggctgg      1380
     gtgctgttcg atctggttac cagcccgatt ctgcaatcga tgtgcgccgt gctggccggg      1440
     gtggtgttct tcgtcaaccg gaccacgcgc tacaccctgt cgaccgccgc catcacggtg      1500
     atggtgctgt tctgcttcaa tcaggtcggt gatggttatg gcctgttcct gccgcggctg      1560
     ttcgatacat tgctgggcag ccttatcgcc ggtctcgccg tgttcctgtt tttgccggac      1620
     tggcagggac gacgcctgaa caaggtgctg gccaataccc tgacctgcaa cagcatctac      1680
     ctgcggcaga tcatgcaaca gtacgccaag ggcaagagtg acgacctggc ctatcgactg      1740
     gcgcggcgca acgcccacaa cgccgacgcc gcgctgtcga ccacgctggc gaacatgctc      1800
     atggagcccg gccactttcg caaggaggcc gacgtcggct tccgctttct ggtgctgtca      1860
     cacacgctgc tgagctacct ttccggcctc ggcgcgcacc gtgatacgca gttgccgagt      1920
     gatgtccgcg aacacctgat cgataacgtc ggtgccacac tggccgccag catcgacgaa      1980
     atcgctgcag ggctagccga gaagaagccg gttgcggtgc agagcgatgc cgaggaaggg      2040
     ctggccgcgc aactggagca actgcccgaa gacatggacg aaagtcagcg actggtgcaa      2100
     gcccagctgg cgctgatctg ccgccagctg gctccgctgc gcaccctcgc cgcgcacttg      2160
     atcaaagctc cggaggttgc tgcaacccat gcagtctga                             2199
//

If you have problems or comments...

PBIL Back to PBIL home page