(data stored in ACNUC7421 zone)

EMBL: CP000075.PE524

CP000075.PE524       Location/Qualifiers
FT   CDS_pept        586426..587160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0524"
FT                   /product="Lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35594"
FT                   /db_xref="GOA:Q4ZZ28"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35594.1"
FT                   /translation="MAGWKLEPEYAFLEQEFGSLDAVFALQGQQLTRDPLSDVIRVERA
FT                   GVYYYVKRYVGAGKGLRRYMGKPRVKSEWQNLKRFAKWGIPTAEVVAWGLERNGAAYDR
FT                   GALITRGLPNTEDLSALAQRKDPRLADRHWVDAVSRQLAAFTRIMHDNHFTHNDLKWRN
FT                   LLVDNEGKLFFIDCPNGAFWWSFMLRYRITKDLACLDKVAKYHLSATQRLRFYLQYRQR
FT                   TRLNASDKKRIRHIVSFFEGRE"
     atggcgggct ggaagctcga gcccgagtac gcgttcctgg aacaggaatt cggtagcctg        60
     gatgccgtat ttgccctgca gggacagcag ttgacccgcg acccgctgtc cgacgtcatt       120
     cgcgtcgagc gcgccggggt ttactactac gtcaaacgct acgtgggcgc gggcaagggc       180
     ctacgtcgct atatgggcaa gccgagggtc aagtccgaat ggcagaacct caagcgcttt       240
     gccaaatggg gcattcccac cgcagaagtc gtggcctggg ggctggagcg caacggcgcg       300
     gcgtatgatc gcggcgcact gatcacgcga ggcttgccga acactgaaga cttgtcggca       360
     ctggcgcaac gcaaggatcc gcgactggcc gaccgccact gggtcgatgc agtcagtcgc       420
     caattggctg cctttacccg gatcatgcac gacaaccatt tcacgcataa cgatttgaaa       480
     tggcgcaacc tgttggtcga taacgagggc aagctgtttt tcatcgattg ccccaatggt       540
     gcattctggt ggagcttcat gctgcgctat cggatcacca aggatctggc ctgcctggac       600
     aaggtcgcca agtatcattt gtcagccacc cagcgcctgc gcttctacct gcaataccgc       660
     cagcgaacgc gtttgaacgc ctccgacaag aaacgtattc gacatatcgt cagctttttc       720
     gagggccgtg aatga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page