(data stored in ACNUC7421 zone)

EMBL: CP000075.PE525

CP000075.PE525       Location/Qualifiers
FT   CDS_pept        587157..587936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0525"
FT                   /product="Lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35595"
FT                   /db_xref="GOA:Q4ZZ27"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027023"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35595.1"
FT                   /translation="MSVFIASADQPLLARHNLADFESLWNIRLDAVDEPNTGRGGWSSV
FT                   FRLDLDGQGFYLKRQSNYLTHTLHHPFGEPSFSREFRNISRYRKLGIPALQAVFYGERK
FT                   VDGERRAILMTRALDGWTDLDELLQQWNQMEAPQRQAILHACGQLARTLHRAGQVHGCF
FT                   YPKHIFLQAAGTGYQAQLIDLEKTRPVIFGKRDLARDLEPLLRRAPMWNEADRRELLAA
FT                   YLHATPNSLLVDAWSARLGKRGAHKRDLQHSDDKETR"
     atgagcgttt ttattgccag tgccgaccag cctttactgg cgcgtcacaa cctggctgat        60
     tttgaatcgc tttggaacat caggcttgat gcggtcgatg agcccaatac cgggcgcggc       120
     ggctggagca gtgtgttccg cctcgacctg gacggtcagg gtttttacct caagcgtcag       180
     agcaattacc tgacgcacac gttgcatcac ccgtttggcg aaccgtcgtt ttcgcgcgag       240
     tttcgtaaca tcagtcgcta tcgcaagctg gggattccgg cgttgcaggc ggtgttctat       300
     ggcgagcgca aggtcgacgg cgaacgccgg gcgatcctga tgacgcgtgc gctggacggc       360
     tggaccgatc ttgacgagct gttgcagcag tggaaccaga tggaggcccc tcagcgtcag       420
     gcaatactgc acgcctgcgg ccagctggcg cgcacgctgc accgcgccgg acaggtacat       480
     ggctgcttct accccaaaca tatttttctt caggcagccg gtaccgggta tcaggcgcaa       540
     ctgatcgacc tggaaaagac ccgcccggtg atttttggca agcgtgacct tgcccgcgac       600
     ctcgaaccgc tgctgcgccg cgcgccgatg tggaatgagg ccgatcggcg cgagctgctg       660
     gcggcttatc tgcacgccac gccaaacagc ctgctggtcg acgcctggag tgcgcgcctt       720
     ggcaaacgcg gcgctcacaa acgagacctt caacacagcg atgataaaga gacccgttga       780
//

If you have problems or comments...

PBIL Back to PBIL home page