(data stored in ACNUC7421 zone)

EMBL: CP000075.PE53

CP000075.PE53        Location/Qualifiers
FT   CDS_pept        54432..54908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35127"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35127.1"
FT                   /translation="MPSALWSFTLDFYARPGVEQACLTLQANGANVCMVLCGVWLGTRD
FT                   VACDAQRVAQIKQLATPWHDDVVRPLRDLRNQWRHAALEDAQLSALRMKVKALELEAEQ
FT                   GLMMKLEALTGDWPAGEARNAEEWLLELAEVDAEKNRDALHVLRIAVGLAVDQT"
     atgccttcag cgctctggag tttcaccctc gatttctacg cccgaccggg tgtggaacag        60
     gcttgcctga cgctgcaagc caacggggcc aacgtgtgca tggtgctttg cggggtgtgg       120
     ctgggcacgc gcgacgtggc gtgcgatgct cagcgagtgg cgcaaataaa gcagttggcg       180
     acaccctggc atgacgatgt ggtgcgtccg ttgcgggatt tgcgtaacca atggcgccat       240
     gcggcgcttg aagacgcaca gctcagtgcg ttgcgaatga aggtcaaggc gctggaactg       300
     gaggccgaac agggtctgat gatgaagctt gaggcactga ccggggactg gccggcgggt       360
     gaggcgagga atgcagagga gtggctgctc gaacttgccg aagtggacgc agaaaaaaac       420
     cgcgatgcgc tgcatgtgct gcgcatcgcg gttggacttg ccgtcgacca gacttag          477
//

If you have problems or comments...

PBIL Back to PBIL home page