(data stored in ACNUC7421 zone)

EMBL: CP000075.PE531

CP000075.PE531       Location/Qualifiers
FT   CDS_pept        599742..601151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0531"
FT                   /product="LmbE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35601"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35601.1"
FT                   /translation="MSRKQQLLKRHRRNKRLALLGGLLLLIAVGVLVAWWLAPVLAVCA
FT                   WVAHEAWFADHLFYSPSDDYQYTFAADSEVPGVRLDGGTLLIDPAVQLNGDETLILALT
FT                   VKSTWLGRFLDPVVELQGQGLNDQQAFERGVCGVRYLNLTGLGEPLAAGVLKLRGRCCR
FT                   LAGTPRLWLFRQPDARKQRVMVIAPHADDAELAAFGLYSQAEEAWIITLTAGEIEAEHY
FT                   RQMGMERAEAARMKGRLRAWDSIAVARWGGVPESQCVQLGYFCLQLPAMQAAPDTPVGS
FT                   READLTDTRLFRQFNTLPLPGDNGQPTWNNLLADLRALILKARPQVVVMPHPAIDPHPD
FT                   HICAQAAVREALLGLEWQPDVVLGYANHLHDNDRWPMGDAYSGISLPPVFDATLPLVPY
FT                   SLQLSVAAQRDKAMALGMMHDLLPRMPFKRRVRRALQRVLAGRHWPAEGENEFFRKAVR
FT                   RHELFWCSRDL"
     ttgagtcgca agcagcagtt gctcaagcgc catcgccgta acaagcgact ggcgttgctg        60
     ggtggactgc tcctgctgat cgcggtgggc gtgctggtgg cctggtggct ggcgccggtg       120
     ctggccgtgt gtgcctgggt cgcccatgag gcctggttcg ccgatcatct gttctattcg       180
     ccgtctgacg attatcagta cacctttgct gccgacagcg aagtgccggg cgtgcgcctc       240
     gacggcggca cgttgctgat cgaccccgca gtacaactga acggcgacga aacgctgata       300
     ttggcactga cggtcaaaag cacctggctc gggcgctttc tcgatccggt ggtcgagctg       360
     caaggtcagg gcctcaacga ccagcaggca ttcgagcgcg gcgtctgcgg cgtgcgttat       420
     ctgaacctga ccggcctggg cgagccgttg gccgcaggtg tgctgaaact gcgcgggcgt       480
     tgctgccgcc ttgccggcac acctcgtctc tggctgtttc gccaaccgga tgcgcgaaaa       540
     cagcgtgtca tggtcatcgc accgcacgcc gatgatgccg agctggccgc cttcgggctg       600
     tacagccagg ccgaggaggc gtggatcatc acgctgaccg ccggtgagat cgaggccgag       660
     cattatcggc agatgggcat ggagcgtgcc gaagctgcgc gtatgaaggg ccgcttgcgg       720
     gcctgggaca gtatcgccgt ggcgcgctgg ggcggggtgc ccgagtcgca gtgtgtgcaa       780
     ttgggctatt tctgcctgca actgcccgcc atgcaggctg cgccggatac gcctgttggt       840
     tcgcgggaag ccgatctgac cgatacccgc ctgtttcgtc agttcaatac cctgccattg       900
     cccggcgaca acggccagcc gacctggaat aacctgctcg ccgacctgcg cgcgctgatt       960
     ctcaaggccc ggccgcaggt tgtggtgatg ccgcatcctg ccatcgaccc tcatcccgat      1020
     cacatctgcg cccaggctgc ggtgcgtgaa gcgctgctcg ggctcgaatg gcagccggac      1080
     gtagtgctcg gttatgccaa tcacctgcac gacaacgacc gctggccgat gggcgatgcc      1140
     tacagcggca tcagcctgcc gccggtcttc gatgccacgc tgccgctggt gccgtacagc      1200
     cttcaattgt cggtcgccgc gcaacgcgac aaggccatgg cactgggcat gatgcatgac      1260
     ctgctgccac gcatgccgtt caagcgtcgt gtgcgccgtg cgctgcagcg cgttctggcc      1320
     ggtcgtcact ggccagccga gggcgaaaac gaattcttcc gcaaggcggt gcgacgacac      1380
     gagttgttct ggtgcagccg tgatctctga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page