(data stored in SCRATCH zone)

EMBL: CP000075.PE532

CP000075.PE532       Location/Qualifiers
FT   CDS_pept        601182..602138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35602"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35602.1"
FT                   /translation="MKVLLLVQKEQRAILDRLYDGIAAHCECEVRWLSSAEQRNLRGYF
FT                   RREVDVSRYDRIVFFLRFKQEVRQVGFIRTIPNLVILEHDAYQNYIPCKYTGKFSAHYR
FT                   KLPWARVICSGFMVSERLRQEGFDAVFVPKGYDQSLLQLQARERDIELAFVGSTNSVAY
FT                   SGRKALLDELGQVENLLVTRTKSGEEYCDTLNRIRFFVSADVGMGEYMIKNFEAMACGC
FT                   VLLAFDQGAEENRALGFVDMHNIVLYRDIPELREKLAKLRDNVTLASEISCNGQTLVEE
FT                   RFTFHALGKAIVDAMHAPLRSMPAASWIDRLRSQLGW"
     atgaaagttc tactgctggt ccagaaagag cagcgtgcga ttctggaccg tctctatgac        60
     ggcatcgccg cacattgtga atgcgaagtg cgctggctga gctctgcgga gcaacgcaac       120
     ctgcgtggtt atttccgccg cgaggtggac gtcagccgct atgaccggat cgtgtttttc       180
     ctgcgtttca agcaggaagt gcgtcaggtc gggtttatcc gcacgattcc caatctggtc       240
     atcctcgaac acgatgccta ccagaactac attccgtgca aatacaccgg caagttcagc       300
     gcgcactacc gcaagctgcc ctgggcgcgg gtgatctgtt cagggttcat ggtcagcgag       360
     cgcctgcgcc aggaaggctt cgacgcggtg ttcgtgccca agggctatga ccagagcctg       420
     ctgcagttgc aggcacgcga gcgtgacatc gaactggcct tcgtgggcag caccaacagc       480
     gtcgcctaca gcggccgcaa ggcgttgctg gacgagttgg gccaggtcga gaacctgctc       540
     gtcacacgga ccaagtccgg cgaagagtat tgcgacaccc tgaaccgcat ccgttttttc       600
     gtcagtgccg acgtgggcat gggcgaatac atgatcaaga atttcgaggc catggcatgc       660
     ggctgcgtgc tgcttgcctt cgatcagggc gctgaagaaa accgcgcgct gggctttgtc       720
     gacatgcaca acatcgtgct ctatcgcgac attcccgagc ttcgcgaaaa gctggcgaaa       780
     ttgcgcgata acgtcacact ggccagtgaa atatcctgta atgggcagac tttggtcgag       840
     gaacgcttta cattccatgc ccttggaaaa gccatcgtgg acgccatgca tgcgccactg       900
     cgcagcatgc cggcggcgag ctggatcgat cgcctgcggt cacaattggg atggtaa          957
//

If you have problems or comments...

PBIL Back to PBIL home page