(data stored in ACNUC7421 zone)

EMBL: CP000075.PE533

CP000075.PE533       Location/Qualifiers
FT   CDS_pept        602170..602943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0533"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35603"
FT                   /db_xref="GOA:Q4ZZ19"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35603.1"
FT                   /translation="MMVFSENSDITLVVTSCGRFDLLKRTLETFDHFNTAPIRHVLITE
FT                   DSGDDRVQACIPEHWHPHTRFIINNPKLGQMRSVDAAYSLIETSWVFHCEDDWDFYRPH
FT                   FIEESMTLLENDPQALQVWLRSYNHDLRIHSPYVYLNEREVVEGIAFYKLGSHKPEWQG
FT                   FSFNPGLRRLADYQQHAPYAEHGGEKKLSQLFAAQNRYALIMENDAVLHTGFGEHVEVP
FT                   QERLDKQRRKRRDRIKLIVAVLAGLVAGWLLNNVS"
     atgatggtat tcagcgaaaa cagcgacatt acgctggtcg tcaccagttg tggtcgattc        60
     gacctgttga agcgcaccct ggaaacgttc gaccatttca acactgcgcc catacgccat       120
     gtgctgatta ccgaagactc cggcgatgac cgggttcagg catgcattcc cgaacactgg       180
     cacccgcata cgcgattcat catcaacaac cccaagctgg ggcagatgcg ctctgtcgac       240
     gcggcctatt cgctgatcga aacgtcctgg gtgttccatt gcgaagatga ctgggatttc       300
     taccgtccgc acttcatcga agagtcgatg acgctgctgg aaaacgaccc tcaggccttg       360
     caggtctggt tgcgcagcta caatcatgat ctgcgtatcc acagccctta cgtttacctg       420
     aacgagcgtg aagtggtcga gggtatcgcg ttttacaagt tgggctcgca caagccggaa       480
     tggcaggggt tttccttcaa tcctgggctg cgccgcctgg ctgattacca gcagcatgcg       540
     ccttatgccg aacacggtgg cgagaagaaa ctttcacaat tattcgctgc acaaaaccgt       600
     tacgctttga ttatggaaaa tgatgccgtg ttgcacaccg ggtttggtga gcacgtggag       660
     gtgccgcagg agcggcttga caaacagcgt cgcaaacgtc gggatcgcat caagctgatc       720
     gtcgctgtgc tcgctggcct agtagcaggt tggttgctta ataatgtcag ttga             774
//

If you have problems or comments...

PBIL Back to PBIL home page