(data stored in SCRATCH zone)

EMBL: CP000075.PE54

CP000075.PE54        Location/Qualifiers
FT   CDS_pept        complement(54905..55921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0054"
FT                   /product="alginate regulatory protein AlgR3"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35128"
FT                   /db_xref="GOA:Q500P4"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35128.1"
FT                   /translation="MSAKKKPVNTPLHLLQQLSGSLLEHLEDACSQALADAEKLLAKLE
FT                   KQRGKAQEKLHNSRIKLQDAATAGKSKAQAKAKGAVSELEELLDALKDRQTETRTYILH
FT                   LKRDAQESLKLAQGIGRVKEAVGKILTTRDAKPVAPKAVAKTPAAKAPAKTAAKAPVKT
FT                   AAAKPVAKAAAKPSAAAKPAAKTAVAKAPVKAAAKPAPRATAAAKPVAAKTTAAKPAAA
FT                   RTTAAKPAAAKPAATKAPVAKTTASNAAKPAAAKAAAAKAPVKAPVKAPAKAPAKAPVK
FT                   AAAKPVAKPAAKPAVKPAAAKPATPAPAAAKPTTPAPAAPAAAPATPANGATPTSAS"
     atgtcggcca aaaagaagcc agtaaatact ccgttgcatt tgctccaaca attatcgggc        60
     agcttgcttg aacatctgga agacgcctgc tcccaagcct tggctgatgc cgagaaactg       120
     ctcgccaagc ttgagaaaca gcgcggcaag gcacaggaaa aactgcacaa ctcccgcatc       180
     aagttgcagg atgctgccac cgccggaaaa tccaaggcgc aggccaaggc caaaggcgcc       240
     gtgtccgagc tggaagagtt gctggacgct ctcaaggatc gtcagaccga aacccgcact       300
     tacatcctgc acctcaagcg tgatgcccag gaaagcctga aactggccca gggtattggt       360
     cgcgtgaaag aggcggtcgg caagatcctg actactcgcg atgccaagcc tgtcgcaccg       420
     aaagcggtcg ccaagacacc tgctgccaaa gccccggcaa aaaccgcagc gaaagcgccg       480
     gttaaaacag ccgccgccaa gccagtcgcc aaggccgcag ccaagccttc cgcagctgcc       540
     aagccagccg caaaaactgc tgttgccaag gccccggtaa aagccgctgc caaaccggcc       600
     ccccgggcga ctgcagcagc caagcctgtc gcagccaaga caacggccgc caagcctgct       660
     gcagccagga caacggctgc taaaccggcc gcggccaagc ctgctgccac caaggcgccg       720
     gttgccaaga ccaccgccag caacgctgcc aaaccagcag cagcaaaagc ggcggcggcg       780
     aaagcgcctg tgaaagcgcc cgtcaaggct ccggccaaag cacctgccaa ggcacctgtg       840
     aaagcagcag ccaagcctgt cgccaaacct gcggccaagc ctgccgtgaa gccagccgcc       900
     gccaaaccgg ccacgccagc gcctgctgca gccaagccga caacgcctgc acctgccgcg       960
     ccagccgccg caccggcaac acctgccaac ggcgcaacgc caaccagcgc ttcctaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page