(data stored in SCRATCH zone)

EMBL: CP000075.PE56

CP000075.PE56        Location/Qualifiers
FT   CDS_pept        complement(56893..57393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0056"
FT                   /product="Regulator of RNA polymerase sigma(70) subunit,
FT                   Rsd/AlgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35130"
FT                   /db_xref="GOA:Q500P2"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35130.1"
FT                   /translation="MPLKGREKTMLESCQNAQERWGGVNKLIDRWLQSRLKLVEAYDAL
FT                   GDTPAALAADREGLQNFCGILVDYVSAGHFEVYEQLGDEARAFNDKRGLELADTIYPRL
FT                   DFITKFALTFNDRCDKGDCSDATAVAREFNQLGQLLHERFELEDCLIEVLHNSHKEEIA
FT                   AQV"
     atgcccctga agggaagaga gaagaccatg ctggaaagtt gtcagaatgc tcaggaacgc        60
     tggggcgggg tgaacaagct gattgatcgc tggcttcaaa gccgtctcaa actggtcgaa       120
     gcctacgatg cactgggcga cacgcccgca gcgctggcag ccgaccgcga aggcttgcag       180
     aacttttgcg gcattcttgt ggattacgtc tccgccgggc acttcgaggt ttacgaacaa       240
     ctgggtgatg aagcgcgagc gttcaacgac aaacgtgggc tcgaactggc agacacgatc       300
     tatccgcgtc tggacttcat taccaagttt gcgctgacgt tcaatgatcg ctgcgacaag       360
     ggcgactgct cggatgcgac ggcggtggcc cgggagttca accagctggg gcaattgctg       420
     cacgagcgtt tcgagctgga agactgcttg attgaagtcc tgcataactc gcacaaggaa       480
     gagatcgccg ctcaggtgtg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page