(data stored in ACNUC7421 zone)

EMBL: CP000075.PE58

CP000075.PE58        Location/Qualifiers
FT   CDS_pept        complement(57541..58068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0058"
FT                   /product="Disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35132"
FT                   /db_xref="GOA:Q500P0"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500P0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35132.1"
FT                   /translation="MYLARTRFLFFLASLACASIIGVAFYLQQAVGLDPCTLCMVQRAA
FT                   FIACGVLALCAACHAPGPTGTRRYSLGLLLVALAGLAGAGTQVWLQTASADQLIPFITR
FT                   LEQILSLLSLDMCIDRLRSDALFCAEITWTLFGISLPEWSLLAFTGLALLPLYPLFSEL
FT                   SHWLATRDRGGY"
     atgtatctgg ctcgcacacg cttcctgttc ttcctggcat cgctggcctg tgcatcaatc        60
     attggcgtcg ccttttacct gcagcaagcc gtaggtctcg acccttgcac tctgtgcatg       120
     gtgcagcgag ctgcattcat cgcctgtggg gtgctggcgc tctgtgctgc ctgccacgcg       180
     ccaggcccga ccggcacgcg ccgctacagc ctggggcttc tgctggtcgc cctggcaggg       240
     cttgctggcg caggcacaca ggtgtggctg caaaccgctt cggccgatca attgataccg       300
     ttcattacca gactggagca aatattgagc ctgctctccc tggatatgtg catcgaccgg       360
     ctgcgaagcg acgcgctgtt ttgcgccgaa atcacctgga ccctgttcgg tatcagcctg       420
     ccagagtgga gtctgctggc atttacaggc ctggcgctgc tgccgctgta tcctcttttc       480
     agcgaattga gccactggct ggcgaccaga gatcggggcg gctattaa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page