(data stored in SCRATCH zone)

EMBL: CP000075.PE60

CP000075.PE60        Location/Qualifiers
FT   CDS_pept        complement(59526..60701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0060"
FT                   /product="Protein of unknown function DUF513"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35134"
FT                   /db_xref="GOA:Q500N8"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q500N8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35134.1"
FT                   /translation="MIDTCRLRYYAKMQRMGYVSETALPKDEESVLKTPASKPEPVRTE
FT                   RTGSRNSGLVFLALLLAIAGIAVAGWGVWQLRMLQAGHQQQRGQVEDIAEQTLVLAQND
FT                   QQLSARIAQFPPANQLEDSRRLVAQLQGDQQRLSQRLETVLGASRKDWRLAEAEHLLRL
FT                   ASLRLSALQDINSAQALVQGADEILREQDDPGSFAAREQLAKSLAALRSVEQPDRTGLF
FT                   LQLAALREQAVQLNKLAPEYADKGESLMGLTADKTETSRWSQWWDEISHYFRIDFNADK
FT                   DIRPVLAGQSLSQVRLALSLALEQAQWAALNGEPEVYSKAITEAQSVLKANFDQDDPQG
FT                   KALGQGLDAVASQPVSVKTPDLAPTLSAVQAYLERRHAAGQPAEAQQGTSR"
     atgatcgaca cctgtcgttt acgctattac gccaaaatgc aaaggatggg atacgtgagc        60
     gaaacagcct tgcctaaaga cgaagaatcg gtgttgaaaa cgcctgcatc caagcctgag       120
     ccagtccgca ccgagcgcac cggcagccgc aacagtggcc tggtattcct ggccttgctg       180
     ctggcaattg ccggtatcgc cgtcgccggc tggggagtct ggcaactgcg catgttgcag       240
     gccgggcacc agcaacagcg cggacaggtc gaggacatcg ccgaacagac cctggtgctg       300
     gcgcagaatg accagcaact gagcgcacgt atcgcgcaat tcccgccagc caaccaactg       360
     gaagacagcc gccgtctggt cgcgcaactg caaggcgatc agcagcgtct cagccagcga       420
     ctcgaaaccg tgctgggggc gagccgcaag gactggcgtc tggccgaggc cgaacatctg       480
     ctgcgtctgg ccagcctgcg cctttcagcg ctgcaggaca tcaacagcgc gcaggcgctg       540
     gttcagggtg ccgacgaaat tctgcgtgag caggatgatc caggctcctt cgctgcccgc       600
     gagcaactgg ccaagagcct tgccgccctg cgcagcgtcg agcagccgga ccgcaccggg       660
     ctgtttctgc aactggctgc cttgcgtgag caggctgtac agctcaacaa gctggctccc       720
     gaatacgcag acaagggcga gtcgcttatg gggctgaccg ctgacaagac cgaaaccagc       780
     cggtggtcgc agtggtggga cgagatctcc cattacttcc gtatcgattt caacgccgac       840
     aaggacatcc gcccggtact cgccggccag agcctttcgc aggtgcgtct ggccctgagc       900
     ctggcgctgg agcaggcgca gtgggcagcg cttaacggcg agcccgaggt ttattccaag       960
     gccatcaccg aagcgcagag cgttctgaaa gccaacttcg atcaggacga cccacagggc      1020
     aaggcgctcg gccaagggct tgatgccgtc gccagccagc cggtatcggt gaagacaccg      1080
     gatctggcac caaccctgag cgccgtgcag gcctaccttg aacgccgtca cgctgccggc      1140
     cagccagccg aggcgcaaca ggggaccagc cgatga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page