(data stored in SCRATCH zone)

EMBL: CP000075.PE64

CP000075.PE64        Location/Qualifiers
FT   CDS_pept        complement(63388..64470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0064"
FT                   /product="Sensory transduction protein kinase AlgZ"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35138"
FT                   /db_xref="GOA:Q500N4"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q500N4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35138.1"
FT                   /translation="MRIEPVKHDARPAPGKDFFLPELCLPQALLVLVVLAELLVLVLVL
FT                   VEPMRSGFDWVRLALMSLFVQWIVLLSAALLCGLRPWLARLTPGLAGMLSCLLVVGLTL
FT                   LCTAVTDVCQLTGRISVSGMVERYLRYSTIALIMSALMLRYFYLQSQWRKQQQGELRAR
FT                   IESLQARIRPHFLFNTLNSIASLVASNPVKAEQAVLDLSDLFRASLAKPGSLVTWGEEL
FT                   ALAKRYLSIEQYRLGERLQLDWRVSAIPDDLPIPQLTLQPLLENALIYGIAPRVEGGVV
FT                   TVEANYEGGEFILSVSNPYEEVANRQTSNGTQQALTNIGARIAALFGPHASLSVERRDG
FT                   RHYTCLRYPCARLTQEARAI"
     atgcgaatcg aacctgtgaa acacgacgcc cggcccgcgc ccggcaaaga ctttttcctc        60
     cctgaactgt gcctgccgca ggcattgctg gtgctcgtcg tgctggcgga gctgctggtg       120
     ctggttctgg tgctggtgga accgatgcgc agcggcttcg actgggtacg cctggcgttg       180
     atgtcgctgt tcgtgcaatg gatcgtgcta ctgtccgcgg cgctgctgtg cggcttgcgg       240
     ccctggctgg cgcgattgac gccggggctg gcaggcatgc tcagttgcct tctggtggtc       300
     ggcctgacgc tgttgtgcac agccgtcacc gatgtctgtc agcttaccgg gcggatttcg       360
     gtcagcggca tggtcgagcg ttatctgcgc tactcgacga ttgccctgat catgtcggcc       420
     ctgatgctgc gctatttcta tctgcagagt cagtggcgca agcagcaaca gggcgaactg       480
     cgcgccagaa tcgaatcgct gcaagcgcgc atccgcccgc atttcctctt caacacactc       540
     aacagtatcg ccagtctggt ggccagcaac ccggtcaagg ccgagcaggc ggtgctcgat       600
     ctttcggacc tgtttcgcgc cagtctggcc aagccgggca gcctggtgac atggggtgaa       660
     gagctggcat tggcaaaacg atatttatcg attgagcaat atcgtcttgg cgagcgtcta       720
     cagttggact ggagggtgag cgcaattccc gatgacttgc caatccccca gctaaccttg       780
     cagccattac ttgaaaacgc tttgatttat ggcattgctc cgcgggtcga agggggcgtt       840
     gtaacagtcg aagcgaacta tgaaggggga gagttcatat tgagcgtcag caatccctat       900
     gaagaagttg ccaatcggca gacttccaac ggtactcagc aagctctgac gaatataggc       960
     gcacgaattg cggcactttt tggcccgcac gccagtctga gcgtggagcg ccgtgacggt      1020
     cgtcactaca cctgtctacg ctatccttgt gcgagactca cgcaggaagc cagagctata      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page