(data stored in ACNUC7421 zone)

EMBL: CP000075.PE67

CP000075.PE67        Location/Qualifiers
FT   CDS_pept        complement(67651..68844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0067"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35141"
FT                   /db_xref="GOA:Q500N1"
FT                   /db_xref="InterPro:IPR016937"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:Q500N1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35141.1"
FT                   /translation="MLDVNRYVTPVLNLMQRYPGLIAAFGFVSGIASFILVDRQAGLAT
FT                   WIAVVMLISWLWLMVENTMVGLLNKALGREIPQGLLRYGTQMIHQESLFFVLPFFFITT
FT                   TWNSGQAVFTAVLGAAGLISIIDPLYYKWLAPRRWLFMTLHTLTLFAALLTALPIILHL
FT                   TTAESYKLALGVAMLLSAPSLMSNFPLNTWRSALAVISIILAIGAAGWLLRSWVPPATL
FT                   WLTEVAVSPDFDNKNRTPGDSISLISARQLRNGGLYAYTAINAPRGLDERIYHVWWHEG
FT                   EEMDRIALDIHGGRKEGYRAWTRKQNFPEDVTGRWQVRVLTEDGQMIGVLRFVVTDDDQ
FT                   PAVKRPTGRIIKLKPGGDSAEEATPESAPATEPKQEKQEAAPAEPAPAESAPQVPAQ"
     atgcttgacg tgaatcgcta tgtgacgccc gtgctcaact tgatgcagcg ctatccgggg        60
     ctcattgcag cgtttggttt cgtttccggt atcgccagtt tcattctggt cgatcgccag       120
     gcagggctgg caacctggat cgcggtggtg atgctgatca gctggctgtg gctgatggtc       180
     gaaaacacca tggtcgggtt gctcaacaag gcactgggcc gcgagatccc gcagggtttg       240
     ttgcgctacg gcacgcagat gattcatcag gaaagcctgt tcttcgtgct gccgttcttt       300
     ttcatcacca ccacctggaa cagtggtcag gcggtgttca ctgcggtgct cggggccgcc       360
     gggctgatct cgatcatcga ccctctctac tacaaatggc tggcgcccag gcgctggctg       420
     ttcatgacgc tgcacacact gacgctgttc gcggcactgc tgaccgcgct gccgatcatc       480
     ctgcacctga ccaccgccga gagttacaaa ctggccctgg gcgtggcgat gctactgtcg       540
     gcgcccagcc tgatgtcgaa tttcccgctc aacacctggc gcagcgcact ggccgtgatc       600
     agcatcatcc tggccatcgg cgcggcgggc tggttgctgc gctcctgggt gccgcctgcg       660
     acgctgtggt tgaccgaagt ggcggtgagc ccggacttcg ataacaaaaa ccgtacgccg       720
     ggcgacagta tttcgctgat cagcgccagg cagctgcgca acggcggcct gtatgcgtac       780
     accgccatca atgcgccgcg tggcctggac gagcgtatct accatgtgtg gtggcatgaa       840
     ggcgaagaga tggaccgcat cgcgctggat atccacggcg gccgcaagga aggctatcgc       900
     gcctggacgc gcaagcagaa cttcccggag gacgtgacag gacgctggca ggtgagggtg       960
     ctgaccgaag acggccagat gataggcgtg ctgcgttttg tggtcactga cgatgatcaa      1020
     ccggcagtga agcggcctac cggacggata atcaagctca agccaggcgg cgactcggcc      1080
     gaagaggcta cacctgaatc agcccctgca actgagccga aacaggagaa gcaggaggct      1140
     gcgcctgcag agccagcccc cgctgaatct gcgcctcagg ttccggcgca gtaa            1194
//

If you have problems or comments...

PBIL Back to PBIL home page