(data stored in ACNUC7421 zone)

EMBL: CP000075.PE69

CP000075.PE69        Location/Qualifiers
FT   CDS_pept        complement(70375..72027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0069"
FT                   /product="Na+/Pi-cotransporter:Na/Pi cotransporter
FT                   II-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35143"
FT                   /db_xref="GOA:Q500M9"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35143.1"
FT                   /translation="MLTLLDLLSAVALLIWGTHIVRTGILRVYGTQLRRVLSQNMSKRP
FT                   LAFIAGILVTALVQSSNATAMLVTSFVGQGLMTLTPALVIMLGADVGTALMSRVLTFDL
FT                   SWLSPLLIFLGVVFFLSRKQTRAGQLGRVGIGLGLIVLALQLIVEAAAPITQAAGVKVL
FT                   FASLTGDLLLDALVGAMFALISYSSLAAVLLTATLAGTEVIGLPVAIGLVIGANIGSGL
FT                   LAFLSTSMQNVAGRQVALGSLLYKLFGLLLIFPVLDPLVAWIDTLGFSPQELVIGFHLL
FT                   YNTVRCLIMLPTVAPMARLCSYLLPQQNEVGGLAKPRHLDLTALSTPSLALANAVRETL
FT                   RMGDLIESMLASMLAVLRGTQTAVTQEVRRLNDDVEALYSAIKLYLAQMPREDLGEHDN
FT                   RRWAEIIELTINLELASGLIERMLRKIQQQKTAHRRSFSEVGLEELADLQIQLQSNLRL
FT                   GLSVFLSGDHESARQLLREKRQFRAEERRLAHAHVSRLRNKVVQSIETSSLHLELIADM
FT                   KRLNSLFCSSAYVVLETADTGALSSEVEADRSL"
     atgctgaccc tgctcgattt gctatccgcc gtcgccctgc tgatctgggg cacgcatatc        60
     gtgcgcactg gcatccttcg tgtttacggt acacaacttc gtcgtgtgct cagccagaac       120
     atgtccaaac gaccgctcgc gttcatcgcc ggcattctgg tgacagcgct ggtgcagagc       180
     agtaacgcca ccgccatgct ggtgacgtcg ttcgtcggcc aggggctgat gacgctgacg       240
     cctgcgctgg tgatcatgct tggcgccgat gtcggcaccg ccttgatgtc tcgcgtgctg       300
     accttcgatc tgtcatggct gtcgccgtta ttgatcttcc ttggcgtggt gttcttcctg       360
     tcgcgcaagc agacccgtgc cggtcaactg gggcgggtcg gtatcggcct gggcctgatc       420
     gtgctggcct tgcagctgat cgtcgaggcc gccgcaccga tcacccaggc cgcgggggtc       480
     aaggtgctgt tcgcctcgct gaccggcgac ctgctgctgg atgcgctggt gggcgccatg       540
     ttcgcgctga tctcctattc cagcttggca gcagtgctgc tgacggcgac actggcgggc       600
     accgaggtca ttggcttgcc ggtggccatc ggcctggtga tcggggccaa catcggcagc       660
     ggcctgctgg cgttcctcag taccagcatg cagaacgttg ccggtcggca ggtggcgctg       720
     ggcagtcttc tgtacaagct gttcggcctg ctgctgatct ttccggtgct cgatccgctg       780
     gttgcctgga tcgacacgct gggcttcagt ccgcaggaac tggtgatcgg ctttcacctg       840
     ctctacaaca cggtacgctg cctgatcatg ctgcctaccg tggctccgat ggcgcggctc       900
     tgttcgtatc tgctgccgca acagaacgaa gtcggcggcc tggccaaacc gcgtcatctg       960
     gacctgaccg ccctgtcgac gcccagcctt gcgctggcca acgcagtgcg tgaaaccctg      1020
     cgtatgggcg atctgatcga aagcatgctc gcctcgatgc tggcggtgct gcgcggcacg      1080
     caaaccgcag tgacccagga agtgcgccgc ctcaacgacg acgtcgaagc gttgtacagc      1140
     gcgatcaagc tgtacctggc gcagatgccg cgtgaagacc tcggcgagca cgataaccgg      1200
     cgctgggccg agatcatcga gctgaccatc aacctggaac tggccagcgg cctgatcgaa      1260
     cgcatgctgc gcaagatcca gcagcagaag acggcgcatc gccggtcgtt ctctgaagtc      1320
     ggtcttgaag aacttgccga tctgcagatt caattacagt cgaacctgcg tctgggcctc      1380
     tcggtgttcc tcagcggcga tcacgagagc gcccgtcagt tattgcgcga aaagcgtcag      1440
     ttcagggccg aggagcgacg cctggcacac gcccatgtca gccgcctgcg caacaaggtg      1500
     gtccagagta tcgaaaccag ttcgctgcac ctggaactga ttgccgacat gaagcgtctg      1560
     aactcgctgt tctgcagcag cgcctacgtg gtgctggaaa ccgctgacac aggcgccttg      1620
     tcgagcgagg tcgaggccga cagatcactc tga                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page