(data stored in ACNUC7421 zone)

EMBL: CP000075.PE71

CP000075.PE71        Location/Qualifiers
FT   CDS_pept        complement(72996..74972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0071"
FT                   /product="Histidine kinase, HAMP region:Bacterial
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35145"
FT                   /db_xref="GOA:Q500M7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35145.1"
FT                   /translation="MSKPRTRIASQLGIALAVILAVVISGSTLFALRSLDASNLVIREE
FT                   HMSSEARLLADQLNTFHSTLRDSTQRLSGLFEKRFAAGLSLQADKPVTVAGTSTPGLFL
FT                   RDAALNNDFTEVDEFRSMTAGVATIFVRSGDDFIRISTSLSKQDGTRAIGTVLDRKGAA
FT                   YERLIAGQSYVGKAVLFDRYYMTQYSPVRDSSGKIIAALFVGFDYTDAQKTQFDNLKSF
FT                   RIGSTGSLALLDDKGTWLVPPAGVKSLEGAAKSVAELASKPGKAQFWDDGDDNYYSVGQ
FT                   PFAGGPWTVIASMPRKEISEVTWHVGTQLAIGSLLAMLIAVISAIWLLRSKLRPLSELV
FT                   RQADALGAGDLSVRLNVTSNDEIGQLSGSFNKMSEALSSMVSHIRTAAQEVSTRANVLS
FT                   GLSGGAFEGMEQQSGEITSMAGAVEEFSATSMNIADNMGNTERLAQENAQQTRIGRTSM
FT                   EEASSSLQQIATSLSSTAKVIDTLGQRSQEIGSIVGVITSIADQTNLLALNAAIEAARA
FT                   GEQGRGFAVVADEVRSLASRTREATDEISGMIASIQQETGNAISTMQQGNTLMQEGLSL
FT                   NAKVASALAQIDEQSRSAGHQFAAITTATQEQSSTATMLSSNLQSIAMANSEQRQVMSN
FT                   LAITAQELNGLATELRHEVDRFR"
     atgtccaagc ctcgtacccg aattgcttcg caacttggta ttgctctggc cgtgatcctg        60
     gcggtggtta tcagtggtag taccctgttc gcgttgaggt ctctggacgc gtccaacctg       120
     gtcattcgtg aagagcacat gtcgagtgaa gccaggctcc tcgctgacca gctcaacact       180
     ttccacagca cgctgcgcga cagcactcag cgcctgagtg gcctgttcga aaaacgcttc       240
     gccgctggcc ttagcctgca agccgacaag ccggtcacgg tggcgggcac atccacgcca       300
     ggcctgttcc tgcgtgatgc cgcgctgaac aacgacttca ccgaagtcga tgaattccgc       360
     tcgatgaccg ccggcgtcgc gaccattttc gtgcgcagcg gcgacgactt catccgtatc       420
     agcacctccc tgagcaagca ggatggcacg cgcgccatcg gcaccgtgct ggaccgcaag       480
     ggcgcagcct acgagcgttt gatcgccggg cagagctatg tcggcaaagc ggtattgttc       540
     gatcgctatt acatgaccca gtacagcccg gtccgcgaca gcagcggcaa gatcattgcg       600
     gcgctgttcg tagggttcga ttacaccgat gcgcagaaga cccagttcga taacctcaag       660
     agcttccgca tcggctctac cggctcgctg gcgctgctcg acgacaaggg cacctggctg       720
     gttccaccgg cgggcgtcaa atccctggaa ggtgccgcca agtccgttgc cgagcttgcc       780
     agcaaaccag gcaaggcgca gttctgggat gacggggatg acaactatta cagcgtcggc       840
     cagccgttcg ccggcggccc ctggaccgtc atcgccagca tgccgcgcaa ggaaatcagc       900
     gaagtgacct ggcacgtcgg cacgcaactg gcgatcggca gtctgctggc catgctcatc       960
     gccgtgatca gcgccatctg gctgctgcgc agcaagctgc gcccattgtc tgaactggta      1020
     cgccaggccg acgcactggg tgcgggcgac ctgagcgtac gcctgaatgt gaccagcaac      1080
     gacgagatcg ggcagctgtc cggcagcttc aacaagatga gcgaagcact gtcatcgatg      1140
     gtgtcgcata tccgtaccgc ggcgcaggaa gtcagcaccc gcgccaacgt gctgtccggc      1200
     ctgtcgggcg gtgcgttcga gggcatggaa cagcaatccg gcgagatcac cagcatggcc      1260
     ggtgccgtcg aagagttcag cgccacgtcg atgaacatcg ccgacaacat gggcaatacc      1320
     gaacgcctgg cccaggaaaa tgcccagcag acacgcatcg gtcgcacctc gatggaagag      1380
     gcgtcttcgt cgctgcaaca gatcgccact tcgctgagca gcaccgccaa agtcatcgac      1440
     acgctgggcc agcgctcgca ggaaatcggc agcatcgtcg gggtaatcac ctcgattgcc      1500
     gaccagacca acctgctcgc gctcaacgct gccatcgagg ccgcgcgcgc cggcgaacaa      1560
     ggtcgcggct ttgccgtggt ggctgacgaa gtccgcagcc tggcctcgcg cacccgtgaa      1620
     gccaccgatg agatttccgg catgatcgcc agcatccagc aggaaaccgg caacgccatc      1680
     agcaccatgc agcagggcaa tacactgatg caggaaggcc tgtcgctcaa cgccaaagtg      1740
     gcctccgcgc tggcccagat cgacgagcaa agtcgctcgg ccggtcacca gttcgccgcc      1800
     atcaccaccg ccacccagga acaaagcagc actgcgacca tgctcagcag caacctgcaa      1860
     agcatcgcca tggccaacag tgaacagcgc caggtcatgt ccaacctggc catcaccgcc      1920
     caggagctga atggcctggc gacagaactg cgtcacgagg ttgaccggtt ccgttga         1977
//

If you have problems or comments...

PBIL Back to PBIL home page