(data stored in ACNUC7421 zone)

EMBL: CP000075.PE73

CP000075.PE73        Location/Qualifiers
FT   CDS_pept        76238..77620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0073"
FT                   /product="Multi antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35147"
FT                   /db_xref="GOA:Q500M5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35147.1"
FT                   /translation="MQHSALKELWIILRLAGPLIASQMAHMLMVFTDTVMMGKIGPEAL
FT                   AGGGLGAATYSFVSFFCVGVMAAVGTLVSIRHGAGDTEGATRLTQAGLWLAWGMALVAA
FT                   LLLWNLEPILLQFGQAEANVHMAAQFLITLPFALPGLLSFMALRGFTSALGRAGPVMTI
FT                   SLAGAAANFVLNYALIHQWLGLPNLGLMGIGLVTAIVTNCMALALALHIRLHPAYAAYP
FT                   IRKGLSKLSRSHLGELWRLGLPIGGTYAVEVGLFTFAAFCMGAMGSTQMAAHQIALQTV
FT                   SMAFMVPVGMSYAVTMRIGQHYGAGNLLMVRMAGRLGIGFGGCVMLMFGLLFWLAPHLV
FT                   IGLFLDINDPAFAEIVVLATKLLAIAALFEFFDGTQTIAMGAIRGLKDARTTFLIGLGC
FT                   YWLIAAPAAWLLGFSTDAGASGVWWGLALGLFCSAVALTYAFEWKTARLLRQDAAGLPV
FT                   PG"
     atgcagcatt ccgccctcaa agaactctgg atcatcctgc gcctggcggg gccgctgatc        60
     gcgtcacaga tggcgcacat gctgatggtc ttcaccgaca ccgtgatgat gggcaagatc       120
     ggcccggaag ccttggccgg cggtggtctg ggcgctgcca cgtacagctt cgtgtcgttc       180
     ttttgcgtcg gcgtgatggc cgcggtcggc acgctggtct cgattcgtca tggtgccggc       240
     gacaccgaag gcgcgactcg tctgacccag gccggtctgt ggctggcctg gggcatggcg       300
     ctggttgccg cgctgttgct gtggaacctc gaacccatcc tgctgcagtt cggtcaggcc       360
     gaagccaacg tgcatatggc ggctcaattt ctgatcaccc tgcccttcgc cctgcccggc       420
     ctgctcagct tcatggcatt gcgcggcttc accagcgcac tgggtcgcgc ggggccggtg       480
     atgaccatca gcctggccgg tgcggcagcc aacttcgtgc tcaattacgc gttgatccat       540
     caatggctgg ggctgcccaa cctggggctg atgggcatcg ggctggtcac cgcgatcgtc       600
     accaactgca tggccctggc gctggcgctg catatcaggc tgcatccggc ctacgccgca       660
     tacccgatca gaaaggggct ttcgaaactg tcacgcagcc acctgggcga gctgtggcgc       720
     ctcggtttgc cgattggcgg cacctatgca gtggaagtcg ggctgttcac ttttgcggcg       780
     ttctgcatgg gcgcgatggg cagcacgcag atggcggcgc accagatcgc cctgcagact       840
     gtgtccatgg cgttcatggt tccggtgggg atgtcctacg cggtcaccat gcgtatcggc       900
     cagcattatg gcgcgggcaa cctgttgatg gtgcgcatgg ccgggcgtct gggtatcggt       960
     ttcggcggct gtgtgatgct catgttcggg ctgctgttct ggctggcacc gcatctggtc      1020
     atcggcctgt ttctggacat caatgacccg gcgttcgccg agatcgtggt actggccaca      1080
     aaactgctgg cgattgccgc cttgttcgag tttttcgacg gcacgcagac cattgccatg      1140
     ggcgccattc gcgggctcaa ggatgcacgc accaccttcc tgatcggcct gggctgctac      1200
     tggctgatcg ctgcgcctgc cgcgtggttg ctcggcttct ctaccgatgc tggcgcttca      1260
     ggcgtgtggt gggggctggc gctgggcctg ttctgctcgg ccgtggcgct gacctacgca      1320
     tttgaatgga agacggcgcg gctgttgcgt caggacgcag ccgggttgcc ggtgccgggc      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page